CAZyme Information: FOZG_07607-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_07607-t36_1-p1
• CAZy Family: GH13
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	JH717899.1|CGC15	46607.82	8.8988

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717899.1:3532323-3533649(-)

Full Sequence      

MGLLNHETNPISSLIAAFTAWKGLLLAIALGASVGPDYDTSTSLFFNIVHGPATPVPALA
TRLTRWDALYFMHDAVKGKVYEQEWAFGIGLPAVVRGINELFGLEGWDAIIAIAISHVSH
IIAVLSLYQLTIVLCNDRKLAYLAAAVHILSPGGLFLSAPYAESTFACLSFVGNLLFALS
LKASPDSLRRNISVIGAGLLYGVSCIFRSNGLFGGVLFAVEAIKGLTALLGGFTFSKALR
LVAPIIGGLFVAVGFVAPQILAWMRYCNVQDNGEQRPWCTRPLPSIYTFVQKEYWNVGFL
RYWTPNQIPLFLLAAPMLTILIKSGTEVMREPSRGLRAMISGTDEQCRVLVRTLASVQTL
LAVLAITNYHVQIISRISSAYPVWYWWVASCLMDRQRQNLGYGIIMFISMYAMIQGGLFA
SFLPPA

Enzyme Prediction     

No EC number prediction in FOZG_07607-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	426	1.9e-111	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.12e-37	38	426	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.54e-19	65	426	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT64606.1|GT76	7.17e-295	1	426	1	427
QKD53322.1|GT76	2.78e-252	1	354	1	354
CEI41323.1|GT76	5.85e-242	1	426	1	421
CEF85209.1|GT76	1.48e-240	1	426	1	423
QPC63474.1|GT76	4.91e-239	1	426	1	423

PDB Hits     

FOZG_07607-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	2.62e-241	1	426	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.01e-117	7	426	15	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	9.38e-84	3	426	22	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	5.81e-80	4	426	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.05e-56	12	426	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000013

TMHMM  Annotations     

Start	End
13	35
106	128
140	162
212	234
241	263
303	322
400	422