CAZyme Information: FOZG_07519-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_07519-t36_1-p1
• CAZy Family: GH13
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	JH717899.1|CGC9	47839.25	9.7202

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717899.1:3313004-3314373(+)

Full Sequence      

MPSITPFLRTTPLFTISLFLRLALLFYGLYQDTHSALKYTDIDYLVFTDASRFVAEGSSP
YARDTYRYTPLLAWILLPTVRFSAFGKLVFAAADLLAGWLILRVLRRRGMDEATAGGFSA
LWLWNPMVATISTRGSSEGLLGVLTMGLLWAVERRRLSLAAIILGLSVHFKIYPFIYAPA
IVWWMDDARLGKETKPSPAPSSYKEAVSNFFTPDRLKFGLLSLITFMILNLIMFSIYETP
FLVHTYFHHVTRIDHRHNFSPYNVLLYLTSATPADAAPSFRIESFAFLPQLLLSCVLIPL
AIAKRDLATSMMAQTFAFVTFNKVCTSQYFLWYMIFLPLYLPNSSFLRNPKLGISALLLW
VVSQAAWLQQGYQLEFLGISTFFPGLWLASLGFFLVNCWILGFIISDGAARSTRSTIKFH
VE

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	131	405	9.2e-98	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	4.06e-92	13	405	11	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.38e-75	131	405	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	3.26e-05	57	236	47	227	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53244.1|GT50	5.37e-306	1	422	1	422
CCT64532.1|GT50	7.18e-295	1	422	1	422
QGI60860.1|GT50	7.18e-295	1	422	1	422
QGI91761.1|GT50	7.18e-295	1	422	1	422
QGI78047.1|GT50	7.18e-295	1	422	1	422

PDB Hits     

FOZG_07519-t36_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	1.20e-284	1	422	1	422	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	3.84e-172	5	408	21	485	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	9.86e-167	20	415	18	435	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	3.04e-166	7	409	5	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	9.35e-163	17	407	15	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000009

TMHMM  Annotations     

Start	End
10	29
71	93
130	152
159	181
218	237
284	303
318	340
352	368
383	405