CAZyme Information: FOZG_06953-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_06953-t36_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		89894.18	4.0266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717899.1:1631444-1634233(-)

Full Sequence      

MAYSLTTSFLGDSLISGFDWFNGRDLSNGFVQYQDLEGAEQYGLYSVDPFSNTVRLRPDS
ARKFDLNEGRPSIRLESKESYQYGLFIADFQHMPISQCGTWPAFWAYGANWPNNGEVDIL
EGANLAYTNIMSAHTADGCMLDPADSNLFSGNPQSLDCAVGTDNVGCGFTPPASDTSSYG
DGFNAVGGGVYAMEWDSEYISIWHFPRGAIPADIEAKRPDPRKWGLPQSLFGGSKCNVDE
YFNDMRIVLNINFCGDYGEGTWGSSETCRALAPTCREYVASNPLDFQDAYFDVSYIDVYT
RLGGDVPPVVPSSTSEAPTEISIPSASTPGPNTPISGNTRFPNSTAIVTRPRPKEDASAT
AEPTTTTTLTGISSVEVTIPGSGTNSATVSSLPVATGGSSVNPAKIDDYAYLGCFGSQTG
FQTFNEKAESDDMTIEKCIEACNGLTYIGLFEGTCYCASKLDADTRALRNESSCNRPCPG
NDDQFCGGMVSQRSKRSIPLRRDAPNNILLTVYADTSDAGQPDVPPGMGPGVDGTAAGGS
SSPTGGSGQGNSPADGANGSTESDSQTGDSAQRTTNGQAGSSDDLPAATNNRVVADTATV
TDVVAGTDTDAVVFSTLSDGEVLEATQAIPDTGRTVVTSTVTFFTVLPSNPGSLVPQESI
VTMSYSLCDYCDTPTLIQPPMATKVVECDGCGTNGENTVTLTVPVHVTVTVTGTGTGTNA
TQVTGNAAAGVVPDQTREIPPIVPTGMGSNANAGPEVTTIVITYLTTQLVTYGTETRSVA
TETRTMRRTVVVTVSDIETMSILPVPSPGRPNTPISHATPTPGASGAPVVVSSASSRVDD
FFVYFAIVAMAILALSL

Enzyme Prediction     

No EC number prediction in FOZG_06953-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	51	279	3e-80	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	5.47e-138	2	300	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
396406	WSC	1.91e-15	412	488	1	80	WSC domain. This domain may be involved in carbohydrate binding.
185693	GH16_laminarinase_like	1.14e-11	37	200	27	172	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
214616	WSC	3.83e-07	408	488	1	85	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase
185691	GH16_Strep_laminarinase_like	3.77e-05	94	196	101	182	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52728.1|GH16_1	0.0	11	857	397	1243
CCT64076.1|GH16_1	0.0	1	857	1	852
QGI77567.1|GH16_1	0.0	1	857	1	852
QGI91274.1|GH16_1	0.0	1	857	1	852
QGI60369.1|GH16_1	0.0	1	857	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	2.92e-69	2	300	2	298	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	3.77e-66	11	299	11	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	3.89e-66	11	299	12	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	2.59e-65	11	299	10	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	2.75e-65	11	299	12	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AJR9|EGLX_ARTBC	1.06e-69	3	301	20	316	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|Q9USW3|YHZ7_SCHPO	5.20e-69	3	299	129	417	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	1.55e-64	2	339	32	370	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1
sp|B0XTU6|EGLX_ASPFC	3.74e-64	3	299	32	326	Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_029980 PE=3 SV=1
sp|Q4X084|EGLX_ASPFU	3.74e-64	3	299	32	326	Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_2G14360 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999080	0.000960

TMHMM  Annotations     

There is no transmembrane helices in FOZG_06953-t36_1-p1.