CAZyme Information: FOZG_05981-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_05981-t36_1-p1
• CAZy Family: CE8
• CAZyme Description: pectinesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		44201.58	8.2000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717898.1:4206620-4207885(-)

Full Sequence      

MKGFIIKTAIIAATLFSAATASPKGPVDTYKKCQRQTKRATEGCPKGTLFVAKDDPRADF
SSIQDAIDSLGNTTTAGHILIAPGNYSEQLNVTRRGPLHLIGASNKPWVKDLYADIDVNT
TAQNDVQIWFNLANTNNGSLSDNVFTSVLTVGPNFNATLTGSGPTGFPVPADTPFGCTDF
RAYNIDFRNEFAPRSSGPAHAVGVSRANAGFYSCGFYSYQDTVYIGKLGNAYFYDNIIAG
ETDFLYGFGTAWIEKSTLSLRGCGGGITAWKGTNTTFTNKYGVYIDNSQLIPVNSTIATN
FVGKCALGRPWNSQHKSIFMQSYFDAVILPAGYIEWSKSTPRVDNYTFMATWNDHGPGYN
VEAEKASNVTRVLTDAEVKPYRAPADVFQTPEGKFGHVKWIDKKAL

Enzyme Prediction     

No EC number prediction in FOZG_05981-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	51	381	2e-54	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	4.07e-27	57	381	20	280	putative pectinesterase
178372	PLN02773	2.60e-23	45	339	3	252	pectinesterase
215367	PLN02682	9.04e-22	45	381	67	355	pectinesterase family protein
215383	PLN02713	4.10e-19	180	360	342	520	Probable pectinesterase/pectinesterase inhibitor
215357	PLN02665	6.63e-18	40	381	62	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51850.1|CE8	1.37e-309	1	406	1	406
QGI78782.1|CE8	4.91e-303	1	406	1	406
CCT65443.1|CE8	4.91e-303	1	406	1	406
QGI61595.1|CE8	4.91e-303	1	406	1	406
QPC73408.1|CE8	4.27e-272	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.67e-22	45	373	7	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.66e-22	45	373	7	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.32e-07	214	381	125	292	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	6.73e-23	8	373	3	315	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	5.16e-21	1	333	1	270	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	7.05e-21	1	333	1	270	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.50e-18	45	346	32	284	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q9SIJ9|PME11_ARATH	2.12e-17	57	377	58	316	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999652	CS pos: 21-22. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in FOZG_05981-t36_1-p1.