CAZyme Information: FOZG_04679-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_04679-t36_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		64612.13	7.2553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717898.1:483337-485061(-)

Full Sequence      

MVQVICATSHAEISPLTTVHTTGIRTDFKPAIFIPHSLSIHRYKLLLLSSMTITTKMEPS
FQGNQFFPGTAAYKRANNIYATSTYGVSRDMNPSEILQPASIEDIQEVVKAATKMGKPLA
IRSGGHQYSGASSTGSQGIQLDLKPTFRRPNIDLNILRENGKVYLRSSVSWQLTEIFDFL
KDNGVFMPTGQCSTVCLGGHVQTGGYGMLARSFGLLGDWVRELEIVDYNGDVVKVTKDSH
PDLFYGFLGGSPGNLGVLTHFKIEVQDDNNHQGSKGLWVGFAYKEETLKALLDILVQKGE
DPKLPRGYDFTVNIVSRQANLLDLFPGSEDELKQKLPDDVHDGKDNIADLLKFKYAMIVV
YAQWVNVNEEPYSPDLFTQIKNVPNEFKIVKEAPEGTPMSVIASMWLFGSPREFPYPYDK
RTNSTTSTELSKTGWSSWFSGRINEVIKDKHNGLWVSSQLQVYGGEQSMFRRNAGNGTAY
CFRDATFGGTWDVFYQGTKEAAEKWQAVNDEGRAKYFSKADRRVLWGSYGDWNMKDVWQF
YYDPETYKKMQKIRQTYDPKGTFTANPFCVEALK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	90	266	9.1e-46	0.36681222707423583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.20e-24	93	574	32	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.44e-23	93	236	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
178402	PLN02805	5.90e-10	93	271	134	310	D-lactate dehydrogenase [cytochrome]
215242	PLN02441	5.26e-08	45	266	13	239	cytokinin dehydrogenase
273751	FAD_lactone_ox	2.15e-06	84	265	10	178	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91582.1|GH31	0.0	57	574	1	520
UKZ75824.1|GH31	5.07e-283	58	572	4	521
UKZ49297.1|GH31	2.39e-281	58	572	4	521
QYS96687.1|GH31	8.72e-277	58	572	4	521
AHG26149.1|AA7	4.61e-19	48	331	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EO5_A	3.49e-19	67	267	27	217	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	3.49e-19	67	267	27	217	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYE_A	1.34e-17	60	265	17	208	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYD_A	3.17e-17	60	265	17	208	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	5.62e-17	60	265	17	208	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SA89|BBE12_ARATH	9.93e-20	66	265	56	246	Berberine bridge enzyme-like 12 OS=Arabidopsis thaliana OX=3702 GN=At1g30740 PE=2 SV=1
sp|P9WEY2|DPMAF_METAN	8.82e-19	82	572	52	491	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	2.39e-18	63	265	17	210	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|Q9SVG4|RETOL_ARATH	2.59e-18	54	265	47	254	Berberine bridge enzyme-like 19 OS=Arabidopsis thaliana OX=3702 GN=At4g20830 PE=1 SV=2
sp|Q9SA99|BBE2_ARATH	5.27e-17	48	265	33	247	Berberine bridge enzyme-like 2 OS=Arabidopsis thaliana OX=3702 GN=At1g11770 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998915	0.001099

TMHMM  Annotations     

There is no transmembrane helices in FOZG_04679-t36_1-p1.