CAZyme Information: FOZG_04047-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_04047-t36_1-p1
• CAZy Family: CBM38|GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		58437.11	7.6427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717897.1:4436013-4437693(+)

Full Sequence      

MKFATIIGSALLGFASAGNTTTRKTTYDYIVAGAGASGLIVAERLANAGHKVLLVERGGP
SFYSTGNRDDLMKWNKTVTAYDVPGMAYYTDISPTIQWCTDIAASAGCLLGGSTMLNALM
FVKPRAADFEGWPRGWQWEDGVSDAAKSVFERMPGSILPSADGKRYDDGAFEVMSKFLES
NGWDEVNALENVEAKDKIFTHPPWLISNGLRGGPVRDILPAAQALDNFSLQLHAKVIRAV
RKGPIITGIEVEHDDGSREIIKLSKGGSVVLSSGTHSTPRILFNSGIGPKKQIRIVQSGS
TNVKLPPASQWIDLPVGQRLKDHPIVVVDFQTKNKLQALPREAFTEPNDETVELFAEGSG
LLSQSAQRLNFWKSVEGNDGVTRYVQGTVNAPENNTISAKVYLTHGLTSHGTLEITPGGN
TNITQKPFLNTEGDRDALKTFVAELLSYARKPGSVLSVPNNVTADTILEVSYSGNHHLGS
ANMGAKNDGKSVVGPDTRVWGTKNLFVVDGSMHPEVPTGNTQASIMVAAAHAANKILAVS
SKRH

Enzyme Prediction     

No EC number prediction in FOZG_04047-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	539	2.4e-197	0.9872262773722628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.32e-46	20	538	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	9.59e-34	28	538	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.75e-22	26	537	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.09e-18	428	532	24	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.68e-14	106	325	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50085.1|AA3_1	0.0	1	544	1	544
BAE79276.1|AA3_1	0.0	1	544	1	544
QGI80203.1|AA3_1	0.0	1	544	1	544
QGI63034.1|AA3_1	0.0	1	544	1	544
QGI93920.1|AA3_1	0.0	1	544	1	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	8.80e-98	26	538	229	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1KDG_A	2.61e-94	21	540	2	543	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	1.26e-93	25	540	1	538	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI4_A	4.03e-93	26	539	7	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	6.32e-91	26	539	229	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	3.06e-91	21	540	229	770	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q6FDF9|BETA_ACIAD	2.16e-23	26	536	5	535	Oxygen-dependent choline dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.69e-22	27	537	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	3.02e-22	27	536	6	532	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|Q63KK7|BETA_BURPS	4.10e-22	21	536	2	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain K96243) OX=272560 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001464	0.998497	CS pos: 17-18. Pr: 0.9617

TMHMM  Annotations     

There is no transmembrane helices in FOZG_04047-t36_1-p1.