CAZyme Information: FOZG_03178-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_03178-t36_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	JH717897.1|CGC31	54834.26	5.5342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717897.1:2139956-2142088(+)

Full Sequence      

MSLFSVACETTGLILADRLSESGEKKVLVLEAAPDPNVVAMHQATVAVEYIAGQSKPKCS
IDWNFYTEPQEGLDDRKLAYHRGRGLGGSSILNGFYYRCGSANVDDHWVELREPRLELEE
VYPSFIKSNRFNALNNGTVRDLNNGRNLGVKQGTATLTSKYRRSSAYDYYNAAAKRPNVD
IFHNAPVQQIMFSRSATGVLVATGVSFIDHSQVVTAGIGPQATLDAFNIEPVVINENAGQ
HMMDHNLYSISATVVPESSAHQLMFNSTAVEASQEEYYTTGKGVYTAPGGITKELLFESF
FYPNSPGPTYEPSSDQSYISISVSSMATLSKDKITIQSSGMSDTPIINPNICYRDYSSHY
SLHTNSFQYYTHPADRAIAFNAFRDARKILDHCAFANLTVGPNHREAAPGVINIDSDDDE
AIFDYIKATTVPNLHASGTNRMLPLEDGGVVDSRIHVYGVQGFRNIDSNIMPTGPDVNIA
GPVYMVGEHGATMIKKDWGI

Enzyme Prediction     

No EC number prediction in FOZG_03178-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	11	497	1.8e-44	0.4854368932038835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.78e-42	11	497	18	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.33e-38	12	495	17	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.68e-26	330	489	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	8.71e-25	6	494	6	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
215420	PLN02785	4.24e-09	82	497	127	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49315.1|AA3_2	0.0	41	500	1	473
CCT67729.1|AA3_2	6.45e-261	10	500	40	605
QGI81035.1|AA3_2	6.45e-261	10	500	40	605
QGI63763.1|AA3_2	3.71e-260	10	500	40	605
QGI94646.1|AA3_2	3.71e-260	10	500	40	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.82e-33	6	497	7	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.25e-33	6	497	8	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	3.67e-22	10	498	50	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	1.03e-17	10	497	15	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	7.94e-17	11	497	16	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	6.03e-32	10	496	50	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	1.68e-28	10	488	84	633	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.87e-28	10	494	12	525	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|A0A075TRK9|PATE_PENEN	2.14e-28	10	497	61	627	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|P0DO29|ERIK_HERER	9.38e-26	10	495	43	596	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FOZG_03178-t36_1-p1.