CAZyme Information: FOZG_02586-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_02586-t36_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	JH717897.1|CGC9	73347.16	4.8252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717897.1:707136-709513(-)

Full Sequence      

MVSIMPSDGILLTGTTKDYCTISKSTTGNPGMSSPGENGCTSNCDMKIVNNEKAPDSFKK
VAYYESWNQDRPCMHVDVRTITSAFMSGWTHVHFAFANITSDYKVSVQDTYGQFKNFKGL
KGIKRIIAFGGWSFSVGVDTYTILCEAVKPANREAFANEVVRFVKDHDLDGVDFDWEYPG
APDLPNILKGSPDEPGNYLKFLQLVKSKLPSDKSLSIAAPASFWYLKQFPIAAISRTVDY
IVYMTYDLHVNLTETKSSLAMVTKAGVEARKLVVGVSSYGRSFKMSSARCKGPMCTFTGP
ESGAAKEWADTHNVDSNTDDDEEDLEVIESCDKEYNSIDAILSSTPDYDDKFKWYVDWVK
EGIDAALDAFMKVKSGEGNKYIDCEWTAPNSNGSGLCTNVELRVPVNTPKAANRRFITYK
MRDEEWFYEALLASHEIEKDWVEWKDNADHDICICPNGPHARYVDEKEPNRFAAGPICPC
EAHAGFTMHKNYPRRIQDTSKIVVLNPKAIIEEAIPKTDDLTELLYETYMDSLNEDLDAS
GADAVTAFSMPVFMLEDAIKSIKSVKEIGEKQKETKTRELVLSILSIVFAVIPFAGTAAS
ALGGAAMIARAGLIIGEAGSAALSIVDIVDDPASAPFAVLGLLIGSKGVKVKGLERPSKT
QPTLDGP

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	60	327	1.6e-45	0.6959459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	4.44e-149	59	304	1	266	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.24e-50	59	310	1	267	Glyco_18 domain.
395573	Glyco_hydro_18	2.90e-47	59	287	1	231	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.30e-41	61	284	2	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	1.77e-33	60	248	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48791.1|GH18	0.0	1	667	1	662
UPK95779.1|CBM18|CBM50|GH18	7.66e-263	14	653	455	1212
ALI93563.1|CBM18|CBM50|GH18	7.86e-151	14	650	516	1264
ANH56471.1|CBM18|CBM50|GH18	7.86e-151	14	650	516	1264
BCS24971.1|CBM18|GH18	5.27e-149	14	646	306	1060

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LJY_A	1.91e-17	58	292	1	252	Crystal Structure of a Novel Regulatory 40 kDa Mammary Gland Protein (MGP-40) secreted during Involution [Capra hircus]
6INX_A	2.88e-17	81	284	19	242	Structural insights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
1OWQ_A	3.43e-17	58	289	1	249	Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution [Bos taurus]
1SYT_A	3.43e-17	58	292	1	252	Crystal structure of signalling protein from goat SPG-40 in the presense of N,N',N''-triacetyl-chitotriose at 2.6A resolution [Capra hircus]
1SR0_A	3.43e-17	58	289	1	249	Crystal structure of signalling protein from sheep(SPS-40) at 3.0A resolution using crystal grown in the presence of polysaccharides [Ovis aries],1ZBK_A Recognition of specific peptide sequences by signalling protein from sheep mammary gland (SPS-40): Crystal structure of the complex of SPS-40 with a peptide Trp-Pro-Trp at 2.9A resolution [Ovis aries],1ZL1_A Crystal structure of the complex of signalling protein from sheep (SPS-40) with a designed peptide Trp-His-Trp reveals significance of Asn79 and Trp191 in the complex formation [Ovis aries],2DPE_A Crystal structure of a secretory 40KDA glycoprotein from sheep at 2.0A resolution [Ovis aries],2DSU_A Binding of chitin-like polysaccharide to protective signalling factor: Crystal structure of the complex formed between signalling protein from sheep (SPS-40) with a tetrasaccharide at 2.2 A resolution [Ovis aries],2DSV_A Interactions of protective signalling factor with chitin-like polysaccharide: Crystal structure of the complex between signalling protein from sheep (SPS-40) and a hexasaccharide at 2.5A resolution [Ovis aries],2DSW_A Binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (SPS-40) with a pentasaccharide at 2.8 A resolution [Ovis aries],2FDM_A Crystal structure of the ternary complex of signalling glycoprotein frm sheep (SPS-40)with hexasaccharide (NAG6) and peptide Trp-Pro-Trp at 3.0A resolution [Ovis aries],2G41_A Crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0A resolution [Ovis aries],2G8Z_A Crystal structure of the ternary complex of signalling protein from sheep (SPS-40) with trimer and designed peptide at 2.5A resolution [Ovis aries]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	2.04e-59	14	314	345	646	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36222|CH3L1_HUMAN	1.64e-16	57	300	21	281	Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2
sp|Q6TMG6|CH3L1_SHEEP	1.76e-16	58	289	1	249	Chitinase-3-like protein 1 OS=Ovis aries OX=9940 GN=CHI3L1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	1.78e-16	52	284	33	299	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|Q29411|CH3L1_PIG	2.93e-16	57	289	21	271	Chitinase-3-like protein 1 OS=Sus scrofa OX=9823 GN=CHI3L1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000055

TMHMM  Annotations     

Start	End
580	602