CAZyme Information: FOZG_02194-t36_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_02194-t36_2-p1
• CAZy Family: AA7
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		77660.16	6.5042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717896.1:5917063-5919249(-)

Full Sequence      

MRYARMDVEALIQQLTLEEKVQLTAGVGWWHTAAIERLSIPPIRLSDGPNGVRGTHFFDS
TPSSCLPCGTALGATWNTDLIYRLGRLLSDEAHAKGAHVLLGPTVNIQRGPLGGRGFESF
SEDPVLSGILAGHYVRGVQRNGVSATMKHFACNDMESARMAVDVQITERALREVYLLPFM
IAVEMASPRVFMTAYNKVNGTHAPDNHHLLQDILRDEWKWDGLVVSDWFGTYSTTEAINA
GQDLEMPGPTRWRGETLVHAVTSNKVKRSTLDERVRNILKLVKHSIENTSIPPNAPETQL
QSEENSRLLREAAAESVVLLKNDKGVLPLDPAKPVAVIGPNADISTYCGGGSASLRAYHT
VSPLEGIRGIAKDVSFTKGLYGHRSLPQIGKLLKTVGEQRQGFTLRIYNDPPPSSGPDTR
KVLETRILDDSNIWFVDYEHPALEQVWYTDIEGVLTPEKTGEWDFGLCVHGTGELFIDGE
LVVSNVVDQKPGSSFLGCGTVEKTGSRMLEGGKSYNVVVRWGCDKTSDLKVSGVVDFGQG
GMRLGGCPRLEPRQALQDTVELAKSVDQVVLCVGTSGEWESEGQDRENMSLPPGSDDLIS
AVLQVNPNTVVLIQSGTPVSMPWVDQASTIAQAWFGGNEAGNGIADVLFGAMNPVSHPQS
SRSALLTVLVRQTANHHGKTRVRQPQCLELPIRRWTRSVQRRCACRLSLV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	247	5e-66	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.83e-80	32	373	50	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.64e-49	37	660	101	602	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.06e-42	37	281	63	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	4.84e-40	317	654	1	181	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.44e-33	10	379	55	466	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46578.1|GH3	0.0	27	654	1	628
CCT63210.1|GH3	0.0	6	654	1	649
QGI90581.1|GH3	0.0	6	654	1	649
QGI76869.1|GH3	0.0	6	654	1	649
QGI59669.1|GH3	0.0	6	654	1	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.82e-202	4	654	2	662	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.03e-197	4	654	2	662	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.56e-93	6	654	3	492	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.63e-74	12	379	9	378	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.60e-71	8	378	4	398	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DFA8|BGLI_NEOFI	7.60e-267	5	656	3	651	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.06e-266	5	656	3	651	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	3.06e-266	5	656	3	651	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.18e-263	5	654	3	649	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.18e-263	5	654	3	649	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000024	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FOZG_02194-t36_2-p1.