CAZyme Information: FOZG_02157-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_02157-t36_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823	JH717896.1|CGC28	92551.42	8.8925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717896.1:5846788-5849361(-)

Full Sequence      

MGMAPLNLVDPVVGSATAAVVFTTVSQYVPSRRLELCSEMVCWAVLPFLFRYTALPNTRA
SSPLLNDPRKQRHSSLSQWLVAFSIVAAAFYRAESNTIGFYPLLTPLLLTVQTYFQPSIS
SDPVPTSPLISTIKGTTLVAVLSAFSLSNGDIFGSLISIILVASLFIVYSIFIPGFTVKV
LSLSSVDIETNIKAIAGRTMVLLLIAVAFQTLVLGPPNSNIILVPFTGLVKALSWFFTIQ
AARQTSWCIATTIGTFAIACTRNPFSQTSQLQALSHVAVSILTLYQTSQLLPKQSKGKAL
LWSCLSASIIPYLYNEHMIHDATSSASAVFSSQSHPIELLAQEAKSVFESRLKNQSRTYL
AAVKQYKQRYGLDPPPGFEAWFEYALKHNSPIIDEFDTIHSAISPFLKLSGNEVSEMIGK
VYKTPQSEVWLCQLSGKTAKTKCRHPSRSYDRHYSYIFDKLLWNLPGVLPDVKFLINHFD
EPRVVIPPQAGDVDKAIRLNDMSMHPTWDSLTKSCPLHKTYRDDQSGLETFGLPFVRDHL
SESDLCKHPEYKDIHGAFISPKTFRLIEGLAPVLSTGAFSTMGDILFPSPAYVEEEFQYD
KTHDVPWSKKKNNLYWTGSTTGGYALDDQWRNHQRQRFVALAQNLGHQEHTYLREKDGLI
SSVKSWFLNGRLYDVGFTRIFQCDRKFCRNQSTFFNIKSWADKDAAFHSKLAFDLDGNGI
SGRYYKLLSSNTLPLKQALLREWHDERLVPWVHYIPVSQSLEELPELVNYLTLNKAGQKV
AEKVARQGSEWMAKAVREVDMTIYTWRLLLELARLQDPTRKGT

Enzyme Prediction     

No EC number prediction in FOZG_02157-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	559	816	3.5e-65	0.94

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.69e-10	605	816	78	253	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	3.30e-08	707	820	214	329	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46606.1|GT90	0.0	1	823	1	823
CCT63185.1|GT90	0.0	1	822	1	822
QGI90556.1|GT90	0.0	1	822	1	811
QGI59644.1|GT90	0.0	1	822	1	811
QGI76844.1|GT90	0.0	1	822	1	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.94e-07	561	822	107	351	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.20e-39	335	820	152	660	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	8.94e-08	518	814	94	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.43e-06	710	822	266	379	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.43e-06	561	822	135	379	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999204	0.000806

TMHMM  Annotations     

Start	End
152	174
194	216