CAZyme Information: FOZG_01895-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_01895-t36_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	JH717896.1|CGC15	24047.44	4.4784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717896.1:5230312-5231142(-)

Full Sequence      

MISFMLVLSFLMALASTNSTTDAITCAKGAHLIVARGSLEPEGPGAMGILAEEIIKLIPG
SDMEALVYPALYNEYVESQTEGVRTMNSVINNYVKNCPDTDLILMGYSQGAHVTMDTMCG
ASSEGFPGTLSQPSYITDNVAAIIAMGDPSLTEGQPFLVGTSEGSGIFPRNLPIGCNSIA
SKTVSICDKGDPYCEAGGKDLSVHLSYIKNYGEFTVGHVVKAWKSRN

Enzyme Prediction     

No EC number prediction in FOZG_01895-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	28	213	7.3e-41	0.9312169312169312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	8.20e-40	26	212	1	162	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46824.1|CE5	9.00e-162	1	227	191	417
CCT62942.1|CE5	9.75e-154	1	227	1	227
QGI90331.1|CE5	3.69e-142	1	227	244	470
QGI59422.1|CE5	3.69e-142	1	227	244	470
QGI76630.1|CE5	3.69e-142	1	227	244	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.07e-30	31	213	6	196	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	1.94e-27	31	219	6	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.94e-27	31	219	6	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	2.94e-26	31	219	6	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4PSC_A	4.28e-10	32	210	84	235	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	4.39e-30	13	213	15	227	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	1.87e-26	31	219	33	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.44e-25	31	213	29	219	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|P9WP39|CULP3_MYCTU	1.34e-13	30	221	47	224	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.34e-13	30	221	47	224	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000426	0.999541	CS pos: 17-18. Pr: 0.9010

TMHMM  Annotations     

There is no transmembrane helices in FOZG_01895-t36_1-p1.