CAZyme Information: FOZG_01661-t36_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_01661-t36_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		61932.96	6.8526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717896.1:4560490-4562198(-)

Full Sequence      

MAESHEFRRRVLLLVTTGGFTHAAPVLEIGAVLASRGHDVQFATCAGQEDWTINYPFIKT
VYTVGPAASEDDLDLHYETMRLWRHEHGFGPMMKSKYFFDNFWTDTYKSLRSLCEDGSTR
PDFIVADFFADSAARDMLKQFNIQLASVWPQMPYAMAPVSYHPGQPGFQADGALTSEHAS
LSSRFWNEFVVLAALPTIIPWLIWTKRMRVDAGVNYSHSLLSKPDYLVLVNSFWGLEAPK
ELPPLMAPVGPILSDEYLPLDEDLAQFLSSHDRTIYVCLGTHVNLPCEELEKYLLGFIQA
LDDDSINGVIWSIPQKSRANFDTFKSYNLSDGSSISITDLLNDSHPRFRLPIFAPQRAIL
AHPNTVLFLTHGGGSSANETLFHGTPVLAVGYFFDQLCNSARLKAAGVGISLDKSYLTPS
SISSAIASIITDKDGSFAMNVRRMQGIATLNSKRKHLATDLIEEVMIDQELRFKNGVELR
PMHLQTADMRMPIWKARNWDMWFISLTGLAAGGVASWWFVTNGWKKLPVILIRSMRISRG
FARKMFDSRRA

Enzyme Prediction     

No EC number prediction in FOZG_01661-t36_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	144	445	1.4e-28	0.6413612565445026

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.83e-40	13	419	4	362	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.40e-12	8	466	1	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	1.78e-12	229	418	230	394	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	3.75e-10	248	413	262	413	ecdysteroid UDP-glucosyltransferase; Provisional
215127	PLN02210	5.35e-09	187	412	158	391	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47039.1|GT1	0.0	1	551	1	551
QGI59140.1|GT1	0.0	1	551	1	551
QGI90050.1|GT1	0.0	1	551	1	551
CCT62669.1|GT1	0.0	1	551	1	551
QGI76352.1|GT1	0.0	1	537	1	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	5.33e-14	280	432	19	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.45e-13	259	432	7	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2VCE_A	6.19e-12	228	403	210	396	Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VCH_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana],2VG8_A Characterization and engineering of the bifunctional N- and O- glucosyltransferase involved in xenobiotic metabolism in plants [Arabidopsis thaliana]
2O6L_A	8.59e-12	259	447	6	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
6PNT_A	1.38e-07	353	471	324	437	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36514|UD2C1_RABIT	4.13e-16	229	447	230	421	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q6K1J1|UDB31_CANLF	1.06e-15	218	447	248	449	UDP-glucuronosyltransferase 2B31 OS=Canis lupus familiaris OX=9615 GN=UGT2B31 PE=1 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	1.00e-14	227	433	246	431	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2
sp|P06133|UD2B4_HUMAN	1.34e-14	229	432	257	435	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q8WN97|UDB30_MACFA	1.78e-14	229	432	257	435	UDP-glucuronosyltransferase 2B30 OS=Macaca fascicularis OX=9541 GN=UGT2B30 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.869966	0.130052

TMHMM  Annotations     

Start	End
499	521