CAZyme Information: FOZG_01175-t36_4-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOZG_01175-t36_4-p1
• CAZy Family: AA3
• CAZyme Description: exoglucanase type C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		54694.46	6.7521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo47	18556	660027	365	18191

• Gene Location: location=JH717896.1:3232746-3234417(-)

Full Sequence      

MYRIVATASALIAAARAQQVCSLNTETKPALTWSKCTSSGCSDVKGSVVIDANWRWTHQT
SGSTNCYTGNKWDTSICPDGKTCADKCCLDGADYAGTYGITSSGNQLSLGFVTNGPYSKN
IGSRTYLMENENTYQMFQLLGNEFTFDVDVSGIGCGLNGALYFVSMDEDGGKAKYSGNKA
GAKYGTGYCDAQCPRDVKFINGVANSEGWKPSASDVNAGVGNLGTCCPEMDIWEANSIST
AFTPHPCTKLTQHSCTGDSCGGTYSSDRYGGTCDADGCDFNAYRQGNKTFYGPGSNFNID
TTKKMTVVTQFHKGSNGRLSEITRLYVQNGKVIANSESKIAGNPGSSLTSDFCSKQKSVF
GDIDDFTKKGGWNGMSDALSAPMVLVMSLWHDHHSNMLWLDSTYPTDSTKVGSQRGSCAI
TSGKPSDLERDVPNSKVSFSNIKFGPIGSTYKSDGTTPNPPASSSTTGSSTPTNPPAGSV
DQWGQCGGQNYSGPTTCKSPFTCKKINDFYSQCQ

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	19	451	1.2e-191	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	26	445	2	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	20	450	1	434	Glycosyl hydrolase family 7.
197593	fCBD	6.15e-12	482	514	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	8.99e-11	482	510	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47486.1|CBM1|GH7	0.0	1	514	1	514
AAA65587.1|CBM1|GH7	0.0	1	514	1	514
AAC10999.1|CBM1|GH7	0.0	1	514	1	514
AAA93710.1|CBM1|GH7	0.0	1	514	1	514
QGI58820.1|CBM1|GH7	0.0	1	514	1	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CSI_A	5.39e-226	19	450	2	433	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
5W11_A	1.13e-225	21	450	4	433	Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus],5W11_B Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus]
4V1Z_A	1.60e-201	19	453	2	439	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]
5O59_A	1.01e-192	19	450	2	429	Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O59_B Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O5D_A Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040],5O5D_B Cellobiohydrolase Cel7A from T. atroviride [Trichoderma atroviride IMI 206040]
1Q9H_A	8.60e-191	26	451	9	434	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46238|GUXC_FUSOX	0.0	1	514	1	514	Putative exoglucanase type C OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|Q7SA23|GUX1A_NEUCR	2.77e-250	6	513	6	520	Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cbh-1 PE=3 SV=1
sp|P15828|GUX1_HUMGT	9.27e-238	6	513	7	524	Exoglucanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=CBH-1 PE=1 SV=2
sp|Q0CMT2|CBHB_ASPTN	3.59e-222	1	513	7	540	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhB PE=3 SV=1
sp|A1CU44|CBHB_ASPCL	2.72e-221	9	513	18	538	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000400	0.999567	CS pos: 17-18. Pr: 0.9401

TMHMM  Annotations     

There is no transmembrane helices in FOZG_01175-t36_4-p1.