CAZyme Information: FOYG_16953-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_16953-t42_1-p1
• CAZy Family: GT62
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	JH717853.1|CGC1	91125.83	5.2956

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717853.1:64218-66896(+)

Full Sequence      

MTLATKTVWSLRDILWSATVLSLVYAQNNVGDVGQRSPDDFQWIQPENTTILGQYGDSQA
VYPSPNMTGHGGWEGAFQKAQDFISEMTLDEKVWLVTGAPGPCVGNINPIPRLNFSGLCL
QDGPNGVRMANYVSVFSSGITIASSWDRELFYHRYHAMGREYRAKGAQVALAPVAGPLGR
SPYGGRNWEGFSPDPYLTGVAMEQAVQGIQDAGVQATVKHWLLYEQETARDPVYYLNGTL
KHSTYSSNADDRTVHELYMWPFANAIRAHASSVMCSYNRVNGSYACQNSKLLNGLLKTEL
GFQGYVMTDWEGLHSGLASIEAGADMDQPGFIAPRTPAYDDGYQSYFGYNISTAIKNGTL
SEARLNDMAARILTPYYFLRQDQDFPSLDPAMVLYNNFFNKNEFFGSWNLSGSESRDVRR
DHGDLIRRQAAESTILLKNKNNALPLKAPKNIGLFGNDILPNTQGALVRGTNEFGTLAIG
GGSGNARFTYLVTPLEAIQRRAAQDGTLVQFWANNTLVANSNVTSLWVGHEPDACLIFLK
TRASERLDRGQLYVDWNGDAVVASVAKSCSNTIVVTHSGGLNTMPWADHPNVTAILLAHY
PGQESGNSIVDVLYGRTNPSGRLPYTIPRNASDVNTPPTTNVTTFGIDDWQSWYTEGLEI
DYRYYDAHKISVQYEFGFGLSYTSFELSDLNIRHGGNQRNISSTPQDVKTVPGGNPALWE
VIYEADASVRNTGDVPGSTVVQLYISFPDSVSAPPRQLRGFEKVELSPGERRTLKFDLMR
RDISYWDVVEQQWLIPAGEFVLHAAFSSRDIADTITFNPLGIAQG

Enzyme Prediction     

EC	3.2.1.-:5	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	110	327	4.4e-61	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.97e-56	134	800	118	746	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.39e-53	434	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	3.40e-40	122	456	67	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.43e-35	78	770	51	734	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.72e-31	135	374	87	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP79990.1|GH3	0.0	12	820	9	818
QMW39247.1|GH3	0.0	10	820	3	813
QMW27177.1|GH3	0.0	10	820	3	813
QRD81533.1|GH3	0.0	10	820	3	813
BAE64040.1|GH3|3.2.1.21	0.0	10	820	3	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	1.02e-193	58	811	25	845	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6SZ6_A	8.40e-190	58	811	4	829	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	2.39e-181	58	811	7	832	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5NBS_A	1.48e-180	58	811	20	850	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6JXG_A	3.32e-179	69	811	2	704	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B0F4|BGLG_EMENI	0.0	14	820	8	817	Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglG PE=3 SV=2
sp|Q0CUC1|BGLG_ASPTN	0.0	20	820	12	813	Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglG PE=3 SV=1
sp|Q2U325|BGLG_ASPOR	0.0	10	820	3	813	Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglG PE=3 SV=1
sp|B8NMR5|BGLG_ASPFN	0.0	10	820	3	813	Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglG PE=3 SV=1
sp|A1DC16|BGLG_NEOFI	0.0	10	820	3	813	Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000507	0.999461	CS pos: 26-27. Pr: 0.9696

TMHMM  Annotations     

There is no transmembrane helices in FOYG_16953-t42_1-p1.