CAZyme Information: FOYG_16402-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_16402-t42_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	JH717850.1|CGC10	33984.91	7.1876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717850.1:656169-657339(+)

Full Sequence      

MFSKSVLIALVPFAVAGPIAPRQGLGSGLGSGIPSFGGSTGGLPGLPSSGGSTGGLPSIP
SLPSSGGSTGGLPSIPGLGSGGSSGGIPSIPGLPSSGGSTGGLPSLPIGGGGSSFLPGGS
TGGDTTGDTSGSASTSAPASQPTGSSETPRAEGGSSTSPFGSFLGSAGGSSGGFGGSTQN
GLSGDCKDVTVIFARGTTEMGNVGTAAGPPFFQALAQQLGSDKLAVQGVEYAASVGGIMQ
MGDQAGSQKMVSLVKEAYQKCPKTKVVMSGYSQGAMLVHNAAKSLPADTTSKIAAVVNFG
DPFQGQAIQGVPADRVKIICHAGDGVCAGTAAITPDHLTYSQDANAAAQFVVSKVK

Enzyme Prediction     

No EC number prediction in FOYG_16402-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	186	355	3.3e-47	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.29e-55	186	355	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48196.1|CE5	1.86e-169	1	356	1	356
QGI75372.1|CE5	1.33e-147	1	356	1	364
QGI89066.1|CE5	1.33e-147	1	356	1	364
QGI58153.1|CE5	1.33e-147	1	356	1	364
CCT61737.1|CE5	6.17e-147	1	356	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.62e-46	186	355	79	247	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1AGY_A	1.38e-27	180	356	11	194	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]
1FFA_A	1.96e-27	180	356	25	208	Chain A, CUTINASE [Fusarium vanettenii]
1FFB_A	1.96e-27	180	356	25	208	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	1.96e-27	180	356	25	208	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	2.35e-59	186	351	31	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	6.23e-53	186	351	31	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q9Y7G8|CUTI_PYRBR	4.10e-51	183	356	29	202	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1
sp|Q8X1P1|CUTI_BLUHO	5.74e-47	177	355	57	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|A0A024SC78|CUTI1_HYPJR	2.45e-45	186	355	79	247	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999738	CS pos: 22-23. Pr: 0.9158

TMHMM  Annotations     

There is no transmembrane helices in FOYG_16402-t42_1-p1.