CAZyme Information: FOYG_16359-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_16359-t42_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1268		137596.66	5.2066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717850.1:521211-525272(-)

Full Sequence      

MAGIVDEKAAAGRQHQPRDGDNTNKGAVTSDDLQLPDINPAEGHGAPPPYGENHDQVHFS
QPGFDAGAAITGDGRVNININAKNRRLTDLLAPTLQGQLAPEPEQPELPPAYIPPSLGGL
PGQTPPPKLNVVVQIVGSRGDVQPFIALGKVLKDTYGHRVRIATHPTFQSFVEENGLEFF
SIGGDPAELMAFMVKHPGLMPGFDAITSGEVSKRRKGIQEILMGCWRSCIEGGDGLGPPP
KPHASNAPLDVSLEVPGGPGQEPFVADALIANPPSFAHVHIAEKLGIPVHMMFTMPWSPT
RAFPHPLANIQSSNTDDVMTNYMSYTLVEMMTWQGLGDVINRFREKALDLPPLSLIWAPG
LLARLKISWTYCWSPALIPKPNDWGRHIDIAGFYFLNLASSYTPDPDLEAFLRDGPPPVY
IGFGSIVVDDPNAMTEMIFEAVRLSGVRALVSKGWGGLGADDLGKPDGVFMLGNVPHDWL
FEHVSCVVHHGGAGTTAAGIKAGKPTLVVPFFGDQPFWGAMIARANAGPDPIPYKQLTAE
KLAEAINFCVKPETLEKAKVLGQKIREERGTDVGGKSFHDHLDTDKLRCTLAPSRAAAWR
VRRSQVRLSAFAAAVLVEQGLLQWSDLKLYRMTEYNTEEQPTDPISACTLSLVTDIGGIG
MAIADMPRELFKSMSQPKKKNSTQGEAQDAATPLAPGSETSLPVPQGNESEKRSTPAPSI
ADTETLDSTVPTTAHSNTSQPTLSDTASSVSRPWSPGQSSTQGSVNDKSWREQIKEAASK
QQRRASPVNYVNAAVGTGKGVGRVVTTGARTPMNFCLGLARGFRNMPRLYNDDTIRPVEK
VTGVGSGIVVAGKEFGYGLFDGVTGLVTQPLKGAEKEGVQGLVKGFGKGIGGLIAKPAAG
FWAIPAYTMQGVNAEVSKYFAKSVQNYITSSRATQGQHEMQEATPGERDDVVQRWNNVKF
DLKNFYQWKRKEKVAGKRPEEPRLDSSEAGFERPRTGWRHTKKMSFEERKKLHADKDAWK
RGFLDAPVPQSNASDASSIQTSSSEDPELEKAIRASVLETSRGNSEEDAQVEAAIRESIK
AVRQQVGSSEAGPLPLKDPSIFEDADYQITDEEYQALVEQAIQQSLGNDVPLPDYSDVPE
LDATDTVSQPPAQTSTQEDDAELKRAIEASRNQPPPPLPPREENDDEFERAIAASKEAMK
QESNQRSEEDIVMEYVKRQSLAEEEYRKQMAKGKSAARAGDDDDEELKRAMEESLKMNRG
DASGPSGS

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	256	571	4.4e-57	0.743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.21e-85	129	581	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.74e-45	137	580	10	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	4.51e-20	131	304	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	2.07e-14	413	571	222	379	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	3.29e-08	836	919	2337	2418	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48156.1|GT1	0.0	1	1268	1	1268
QGI89104.1|GT1	0.0	1	1267	1	1269
CCT61772.1|GT1	0.0	1	1267	1	1269
QGI58191.1|GT1	0.0	1	1267	1	1269
QGI75410.1|GT1	0.0	1	1267	1	1269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.61e-74	136	620	27	474	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.42e-74	136	620	47	494	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	2.38e-34	129	586	1	402	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.28e-32	129	576	1	375	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	2.81e-24	281	561	113	379	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	2.57e-122	127	582	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.33e-120	127	586	191	614	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	2.45e-80	107	583	971	1414	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q9Y751|ATG26_KOMPG	5.55e-76	128	599	760	1192	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|A7KAK6|ATG26_PICAN	6.83e-76	136	583	795	1204	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998662	0.001363

TMHMM  Annotations     

There is no transmembrane helices in FOYG_16359-t42_1-p1.