CAZyme Information: FOYG_15573-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15573-t42_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840		92584.02	5.7232

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717849.1:954317-957037(+)

Full Sequence      

MAEANFVDVEALLSNLTLDEKVELLAGQGSFRMTGLEKHGIPALITSDGPHGIRGRRSFT
RMPSPMLPSATGMGATFNTELIHKIGSLLGEEAKVRGVHVLLAPTLCLQRSPLIGRGFEA
FGEDPFLSGTLGAHYINGVQEQGVATSVKHYAAHDQSDNSIEDNVVMTERTLREVHMLPF
QLALRGSDPWTIMTSYNKINGIHVSEDPLLMKEILREEWGFKGLVMSDWFGTYSTSEAIN
AGLDLEMPGPTDWRGKRLSIAVNSRKVSKATVDTAVENVLNLVNKCKAGEKSGKPPQSDT
PEQRALIRQLVAESVVLLKNNKQKLPIKNPKNLKFGLIGDHVKNPALCGGGSAEVEPYYG
ITPYEAIKEVVGEENITYTPGCNSFRFSPLIKGHTPPGSDSEGWSVEIFGDDPQENPDAR
VLVSTTAEKQLVDVPESYHATLPTKFYARAKAKYTIHESGKLKFGFSTSGKGKLIIDGKE
AIDQWTSQPPKTDSTPCFNRLSMEKYYEGEFEKGQVLDLEVLQVNESLSGGVGTAQTLAG
RVGVYELYDEVQGIKDAVELAKKVDVPIVVTGLSSDFEYEGSDRKHLRLPGRVDELIWAV
LEANPDAIIITQSGLPIEMPWESQAATLLHAWFGGQETGHGMADVLFGKVNPSGRLSLTF
PKSIKHTPAYLTFSKADYDIVYGEGVFIGHRYYEMVDREPLFYFGHGLSYSRFEYSNLSV
PEEFTPAADHQMRVTVDIANKGAFAGAEVVQLYIHHADSSLQRPIRELKAFTKVTVDVDE
TKTAELTLDKYSLSFWCQEASKWKAEAGKYTVILASSSNPKDEITRGDFTLPKTFFWKGL

Enzyme Prediction     

No EC number prediction in FOYG_15573-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	37	248	7.8e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.44e-84	9	831	38	764	beta-glucosidase BglX.
224389	BglX	6.36e-77	40	383	59	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.58e-53	40	282	65	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.65e-46	537	689	64	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.21e-39	11	789	55	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62631.1|GH3	0.0	1	840	1	840
CCT75598.1|GH3	0.0	1	840	1	837
QGJ01758.1|GH3	0.0	1	840	1	821
QGI70868.1|GH3	0.0	8	840	294	1107
QGI88206.1|GH3	0.0	1	840	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.00e-191	8	840	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.47e-186	8	840	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.74e-137	7	818	3	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.60e-107	13	818	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.34e-94	9	818	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	3.26e-220	8	840	12	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	5.28e-216	7	840	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	7.46e-216	7	840	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.46e-216	7	840	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.68e-214	8	840	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_15573-t42_1-p1.