CAZyme Information: FOYG_15503-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15503-t42_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59910.70	5.5000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717849.1:794953-796720(-)

Full Sequence      

MASPTYDYIVVGGGLAGCVLSSRIRQYDDAVKILLIEAGKETRERSDVHNMKALNLGSEL
DWQYQSEPVEALMGRRITLNAGKGLGGSSAINSGGWTRGAAADYDEWEALVGDERYSYKG
QLPWFKKSELWFDDKNPEQHGKDGPIRVTCAKASNRMFPLAEQAAAGWEELGVSTLPDGD
QNTGDNLGRAYICEARSDGKREWSANQYSLDGIEVRLETFVNRVIIQKIHGNLKATGVEL
ADSSVVNGHNIIVSAGAFRSPQLLQLSGIGPSTHLEKFGIQPLVDLPEVGKNLSDHMIFF
QHWRLRDPSAGHTIGSANPLFQQPQYSQGVPFDWIVNTGVPKEGLVKAIERDEGAKPNDS
KHVLLAKDRTFIENIVMFAKLPFPGVPMDAKHITSALVSFLPTSTGSVSLKSGKPDDHPK
VNLNYLSTEVDKYVFREGLRQLTRFMLDSKFSDQIIGESIPEGLPVEALAPDDSDEKLDQ
RIAMTGGTSWHPSGTCSMGKVVDTEFRVTGVEGLRVVDASVIPVPLSAHLQAPLYALSEQ
AAAIITGKV

Enzyme Prediction     

No EC number prediction in FOYG_15503-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	546	2.6e-137	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.30e-103	1	548	1	534	choline dehydrogenase; Validated
225186	BetA	2.88e-88	1	545	3	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	9.57e-37	402	541	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.07e-35	5	521	55	552	Protein HOTHEAD
366272	GMC_oxred_N	3.65e-34	6	298	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62572.1|AA3_2	0.0	1	549	1	549
QGI70777.1|AA3_2	0.0	1	549	1	549
CCT75503.1|AA3_2	0.0	1	549	1	549
QGJ01668.1|AA3_2	0.0	1	549	1	549
QGI88121.1|AA3_2	0.0	1	549	1	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	6.27e-65	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	8.73e-65	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.21e-64	1	548	19	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	1.22e-64	1	548	3	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	2.68e-64	1	548	79	639	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.59e-91	3	542	2	515	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	4.63e-67	3	548	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.63e-67	6	548	5	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	1.10e-66	1	548	1	535	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	2.45e-66	3	548	2	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000040

TMHMM  Annotations     

There is no transmembrane helices in FOYG_15503-t42_1-p1.