CAZyme Information: FOYG_15125-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15125-t42_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201		22619.55	6.2482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:2379602-2380207(-)

Full Sequence      

MPLGGSVTYGVGSSDGNGYRKFLQDLLLANGYEVSMVGSRKAGSMHNNENEGWRGYRLDQ
IESKARRSVVTVKPNLFAINAGSNDCIQNYQLDVFRERMDNLLEYLWKTSPLSTVILSTL
LVNVDEQVNSRVLDINSYLRDLVVLKEFERKRIVLADMYSTKGADLDDLMDGTHPNDDGY
NKMAHIWFNAIQKARANGFVG

Enzyme Prediction     

No EC number prediction in FOYG_15125-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	1	191	6.2e-54	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.56e-34	1	191	4	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.05e-15	3	180	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.59e-14	3	190	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	5.13e-10	1	187	2	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	1.46e-08	3	187	7	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62224.1|CE3	3.19e-135	1	199	1	199
QGI68641.1|CE3	5.81e-116	1	199	55	253
QYT04935.1|CE3	1.31e-76	1	200	55	254
CAP79838.1|CE0	5.98e-74	1	200	107	306
UKZ86526.1|CE0	2.69e-73	1	200	1	200

PDB Hits     

FOYG_15125-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	4.63e-15	1	192	47	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_15125-t42_1-p1.