CAZyme Information: FOYG_15079-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15079-t42_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	JH717848.1|CGC21	59154.19	7.1573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:2206301-2207968(-)

Full Sequence      

MLFSLVLSVLAAHAGLALGDTSVTVNINKRLQVIDGFGVSEAYGHAKQFQNLGPGPQKEG
LDLLFNTTTGAGLSIIRNKIGCDDSNSITSTNTDNPAKQPVFHFDGDDDGQVWFSKQAMS
YGVATIYANAWSAPLYMKSAKSMGRLCGTPGVSCASGDWRHRYVEIIVQYLSYYKEAGIP
VSHVGFLNEGDGSDFMLSSAEQAADVIPLLHSALNSKGLGDIKMTCCDNIGWKSQMEYTA
KLAELGVESYLSVITSHEYSSSPDQPMNTTLPTWMSEGAANDQAFATAWYVNGGSNEGFT
WAVKIAQGIVNADLSAYIYWEGVETNNRGSLSHVIDTDGTKFTISSILWAIAHWSRHIRP
GAHRLSTSGVVQDTIVGAFENVDGSVVLVLTNTGTTAQTVDLGVTGSTFSTAQAFTSDTE
AQMVNTEVTVSDNRVKVTVPVHGVVTVKLTTAKSSNPVSTAISLQSVPTPASDENSSVRQ
KPSSTTLSIVRAPTHGQATSVVESAKATKYPAPAVTPKSSKKSAAKKDSHRSHSTHVAAH
RRCGHGSHRRGHCTK

Enzyme Prediction     

No EC number prediction in FOYG_15079-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	447	3.5e-166	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	8.98e-20	3	446	16	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	1.04e-07	54	356	20	293	Glycosyl hydrolase family 59.
407314	Glyco_hydro_30C	1.30e-04	361	411	1	52	Glycosyl hydrolase family 30 beta sandwich domain.
405300	Glyco_hydr_30_2	2.43e-04	23	327	2	360	O-Glycosyl hydrolase family 30.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62186.1|GH30_7	0.0	1	555	1	555
CCT73001.1|GH30_7	0.0	1	555	1	560
QGI99497.1|GH30_7	0.0	1	555	1	560
QGI85808.1|GH30_7	0.0	1	555	1	560
QGI68607.1|GH30_7	0.0	1	555	1	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	1.25e-106	11	451	14	455	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	3.33e-92	21	449	3	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	6.13e-91	21	449	10	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	1.34e-82	1	405	1	426	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.54e-80	20	405	92	497	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	4.53e-92	21	449	27	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	8.90e-08	19	399	83	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999736	CS pos: 19-20. Pr: 0.9239

TMHMM  Annotations     

There is no transmembrane helices in FOYG_15079-t42_1-p1.