CAZyme Information: FOYG_15076-t42_5-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15076-t42_5-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		100145.38	5.3835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:2195920-2198806(+)

Full Sequence      

MQVATAFSDEKEQEQQVSDNVLVIEIAGPDLFSMEIVDTPGLSSSPTVDDAQELTRALIL
DLVKQPNTIILAVVDATNDMSSQEGPRLARAADVTGNRTVAVVTKCDLVPPEERRFVLRA
MRNKERHLGHPWFATRSLSCDERDQDCTLETRNSIEGSLFSEKEWAVLKRRRRVGALALR
DHLKTRVNVMLRGSIDLLTTLLNTPAHSVAPIDTANTDKVQPTDVYATSQETVVADADLE
FASDAPRPTPLLNAVIVALTVAICLCLIALGCSTMAMEIASEGGWTRLFLLITAVPQIIL
SLFFCQAIVVTTFQMIGPVTQLKVNSKFYSAKRTRRLDGTKVLLPHVTIQCPVYKEGLEG
VIRPTVRSLSAAIRNYESFGGTASIFINDDGMQLVSPEEADERRMFYKENNIGWVARPAH
NANGEGISKFIRRGKFKKASNMNYALGISLKVEDKLVQIVRDEHWTQADESAAYQRCLDE
VLSEELGRAWVGGDIRVGDYLLLVDSDTRVPTDCLIDAVSELEASPRVAILQFTSGVMNV
TTSYFESGITFFTNLIYTAIAYAVANGDVSPFVGHNAFIRWSALQEVGSQDDGIICNEKD
PNATTPYEKFWSESHVSEDFDVSLRLQTLGYHIRLATYCGDGFKEGVSLTVYDELARWQK
YAYGCSELLFYPMKDWWRYGIFTSLFKRFIMSNMPLGSKITIMSYIGTYYAIGYSWIGSL
LNYFLIGWLNGELDHYYMSSWRVWVALVVVFSIAGNITLALIRYRSQQVSLLRELWTCFK
WVALMFVFLGGISMHVCKAILCHMLSIDIGWGATSKEVEDTNFFQEISIIIAGFKYVFIF
CPAVTALMICGVYAFPYLWRINELVAIFPLATVIFCHFFLPIALNPNLMKFTW

Enzyme Prediction     

No EC number prediction in FOYG_15076-t42_5-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	500	725	6.2e-48	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.36e-43	500	726	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
206738	DLP_1	2.31e-38	14	183	92	265	Dynamin_like protein family includes dynamins and Mx proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.
395279	Dynamin_N	3.66e-17	2	105	67	167	Dynamin family.
224136	BcsA	1.21e-14	498	819	138	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
197491	DYNc	1.50e-10	17	109	110	205	Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62182.1|GT0	0.0	1	893	1	912
CCT73007.1|GT0	0.0	1	893	122	1016
QGI99503.1|GT0	0.0	1	893	122	1034
QGI68613.1|GT0	0.0	1	893	122	1034
QGI85813.1|GT0	0.0	232	893	5	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FGZ_A	5.87e-13	17	109	149	244	Cyanidioschyzon merolae Dnm1 (CmDnm1) [Cyanidioschyzon merolae]
3W6N_A	1.87e-12	17	109	127	222	Crystal structure of human Dlp1 in complex with GMP-PN.Pi [Homo sapiens],3W6N_B Crystal structure of human Dlp1 in complex with GMP-PN.Pi [Homo sapiens],3W6O_A Crystal structure of human Dlp1 in complex with GMP-PCP [Homo sapiens],3W6O_B Crystal structure of human Dlp1 in complex with GMP-PCP [Homo sapiens],3W6P_A Crystal structure of human Dlp1 in complex with GDP.AlF4 [Homo sapiens],3W6P_B Crystal structure of human Dlp1 in complex with GDP.AlF4 [Homo sapiens]
4H1U_A	1.94e-12	17	109	125	220	Nucleotide-free human dynamin-1-like protein GTPase-GED fusion [Homo sapiens],4H1V_A GMP-PNP bound dynamin-1-like protein GTPase-GED fusion [Homo sapiens]
4BEJ_A	4.45e-12	17	109	132	227	Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_B Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_C Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_D Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens]
5WP9_A	4.97e-12	17	109	125	220	Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_C Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_E Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_G Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_I Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_K Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_M Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_O Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SXN5|DNM1L_DANRE	3.66e-12	17	109	124	219	Dynamin-1-like protein OS=Danio rerio OX=7955 GN=dnm1l PE=2 SV=1
sp|O00429|DNM1L_HUMAN	2.62e-11	17	109	125	220	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2
sp|Q2KIA5|DNM1L_BOVIN	2.65e-11	17	109	138	233	Dynamin-1-like protein OS=Bos taurus OX=9913 GN=DNM1L PE=2 SV=1
sp|Q8K1M6|DNM1L_MOUSE	3.46e-11	17	109	131	226	Dynamin-1-like protein OS=Mus musculus OX=10090 GN=Dnm1l PE=1 SV=2
sp|O35303|DNM1L_RAT	3.50e-11	17	109	138	233	Dynamin-1-like protein OS=Rattus norvegicus OX=10116 GN=Dnm1l PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000001

TMHMM  Annotations     

Start	End
251	273
288	310
706	728
743	762
775	797
836	858
865	884