CAZyme Information: FOYG_15076-t42_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15076-t42_2-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1029		114284.31	6.1054

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:2195390-2198806(+)

Full Sequence      

MIDMIDSGTIGRSVSMSGAAANGSPGRVTGLSLGTSTPVPVVAIIGDKGSGKTSLFEALS
GLSLHGSRLSSTKFPIHAYFTHTSRAGTTLKARINPGKVDGQNKELSEHLQSFEVNYDGD
LAAVNLPHIVRQATNHMQVATAFSDEKEQEQQVSDNVLVIEIAGPDLFSMEIVDTPGLSS
SPTVDDAQELTRALILDLVKQPNTIILAVVDATNDMSSQEGPRLARAADVTGNRTVAVVT
KCDLVPPEERRFVLRAMRNKERHLGHPWFATRSLSCDERDQDCTLETRNSIEGSLFSEKE
WAVLKRRRRVGALALRDHLKTRVNVMLRGSIDLLTTLLNTPAHSVAPIDTANTDKVQPTD
VYATSQETVVADADLEFASDAPRPTPLLNAVIVALTVAICLCLIALGCSTMAMEIASEGG
WTRLFLLITAVPQIILSLFFCQAIVVTTFQMIGPVTQLKVNSKFYSAKRTRRLDGTKVLL
PHVTIQCPVYKEGLEGVIRPTVRSLSAAIRNYESFGGTASIFINDDGMQLVSPEEADERR
MFYKENNIGWVARPAHNANGEGISKFIRRGKFKKASNMNYALGISLKVEDKLVQIVRDEH
WTQADESAAYQRCLDEVLSEELGRAWVGGDIRVGDYLLLVDSDTRVPTDCLIDAVSELEA
SPRVAILQFTSGVMNVTTSYFESGITFFTNLIYTAIAYAVANGDVSPFVGHNAFIRWSAL
QEVGSQDDGIICNEKDPNATTPYEKFWSESHVSEDFDVSLRLQTLGYHIRLATYCGDGFK
EGVSLTVYDELARWQKYAYGCSELLFYPMKDWWRYGIFTSLFKRFIMSNMPLGSKITIMS
YIGTYYAIGYSWIGSLLNYFLIGWLNGELDHYYMSSWRVWVALVVVFSIAGNITLALIRY
RSQQVSLLRELWTCFKWVALMFVFLGGISMHVCKAILCHMLSIDIGWGATSKEVEDTNFF
QEISIIIAGFKYVFIFCPAVTALMICGVYAFPYLWRINELVAIFPLATVIFCHFFLPIAL
NPNLMKFTW

Enzyme Prediction     

No EC number prediction in FOYG_15076-t42_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	636	861	1e-47	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
206738	DLP_1	1.06e-46	38	319	2	265	Dynamin_like protein family includes dynamins and Mx proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.
404513	Glyco_trans_2_3	6.35e-44	636	862	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
395279	Dynamin_N	1.72e-21	42	241	1	167	Dynamin family.
224136	BcsA	2.57e-15	424	955	1	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
197491	DYNc	3.93e-13	32	245	17	205	Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and plasma membrane following an exocytic event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73007.1|GT0	0.0	16	1029	1	1016
QGI99503.1|GT0	0.0	16	1029	1	1034
QGI68613.1|GT0	0.0	16	1029	1	1034
QKD62182.1|GT0	0.0	137	1029	1	912
QGI85813.1|GT0	0.0	368	1029	5	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6N_A	3.91e-15	39	245	27	222	Crystal structure of human Dlp1 in complex with GMP-PN.Pi [Homo sapiens],3W6N_B Crystal structure of human Dlp1 in complex with GMP-PN.Pi [Homo sapiens],3W6O_A Crystal structure of human Dlp1 in complex with GMP-PCP [Homo sapiens],3W6O_B Crystal structure of human Dlp1 in complex with GMP-PCP [Homo sapiens],3W6P_A Crystal structure of human Dlp1 in complex with GDP.AlF4 [Homo sapiens],3W6P_B Crystal structure of human Dlp1 in complex with GDP.AlF4 [Homo sapiens]
4H1U_A	4.10e-15	39	245	25	220	Nucleotide-free human dynamin-1-like protein GTPase-GED fusion [Homo sapiens],4H1V_A GMP-PNP bound dynamin-1-like protein GTPase-GED fusion [Homo sapiens]
4BEJ_A	1.26e-14	39	245	32	227	Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_B Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_C Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens],4BEJ_D Nucleotide-free Dynamin 1-like protein (DNM1L, DRP1, DLP1) [Homo sapiens]
5WP9_A	1.46e-14	39	245	25	220	Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_C Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_E Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_G Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_I Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_K Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_M Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens],5WP9_O Structural Basis of Mitochondrial Receptor Binding and Constriction by Dynamin-Related Protein 1 [Homo sapiens]
4P4S_A	1.62e-13	39	296	13	246	GMPPCP-bound stalkless-MxA [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SXN5|DNM1L_DANRE	1.07e-14	39	245	25	219	Dynamin-1-like protein OS=Danio rerio OX=7955 GN=dnm1l PE=2 SV=1
sp|A7VK00|MX2_PIG	3.30e-14	39	264	115	314	Interferon-induced GTP-binding protein Mx2 OS=Sus scrofa OX=9823 GN=MX2 PE=2 SV=1
sp|Q800G5|MXE_DANRE	3.80e-14	39	260	43	240	Interferon-induced GTP-binding protein MxE OS=Danio rerio OX=7955 GN=mxe PE=2 SV=1
sp|Q6PW23|MX_EPICO	3.81e-14	39	298	33	268	Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1
sp|Q9BDI7|MX2_BOVIN	5.70e-14	39	264	115	314	Interferon-induced GTP-binding protein Mx2 OS=Bos taurus OX=9913 GN=MX2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

Start	End
390	412
424	446
679	701
842	864
879	898
911	933
972	994
1001	1020