CAZyme Information: FOYG_15040-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_15040-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		31921.27	8.6408

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:2108331-2109277(-)

Full Sequence      

MLGLPSPRKLLTQLSLGASLVAAQLQTITNFGNTYGTQLTMQAYIPGNLPASPAVMLALH
ACGGNGPGYFQQTKYKSLADSRGVILIFPSSQKDFNCWDVASAKTLKHDGQGDSQVLVSM
VDYVIKTYKADPKKVYVTGTSSGCMMTNVLAATYPDRFAAATCYSGVAAGCMAGSPGSSP
ISSDRVCSDGKIIKTGQQWADQVKSMYPGYSGSYPRFKTWHGTADNLVFYRNLLEQIKEW
STIQGVSFTRNETSTPQSGYTTMIYGDGTKFVAVSAAGVGHVVPTHEDLDFKWFGLT

Enzyme Prediction     

No EC number prediction in FOYG_15040-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	201	7e-25	0.6651982378854625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.89e-37	41	255	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	9.16e-21	36	284	44	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.76e-18	39	173	1	137	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	3.52e-07	26	166	161	302	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	1.08e-06	107	168	38	99	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62144.1|CE1	8.62e-217	1	297	1	297
CCT72967.1|CE1	1.41e-206	1	297	1	297
QGI85778.1|CE1	1.41e-206	1	297	1	297
QGI99467.1|CE1	1.41e-206	1	297	1	297
QGI68577.1|CE1	1.41e-206	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	7.43e-79	22	295	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]
3WYD_A	3.50e-06	36	160	18	136	C-terminal esterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HE18|FAEB_TALFU	2.76e-99	21	297	17	292	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	3.42e-96	22	297	18	292	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	6.43e-86	7	296	3	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|Q96W96|AXE1_ASPFI	2.85e-79	22	295	29	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	2.29e-78	22	295	29	301	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.702003	0.297987

TMHMM  Annotations     

There is no transmembrane helices in FOYG_15040-t42_1-p1.