CAZyme Information: FOYG_14824-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_14824-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		56972.47	7.7056

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:1610831-1612658(-)

Full Sequence      

MPPVEKDPNVNGKPFNLGRIIPNVILPALVGAAVWARQPSDNQFTAPPAALRKCLDSVCA
GADNCVRYPASGENREYFQWASPFNLGRIVLPAAVVRPSTDEQVSGFVQCAADSNVKVQA
RSGGHSYANYGAGGYNGSLSVDLINYRYVTLNKTTWLTTIGGGSLLGDIDDLLDNQKGNR
AFPHGVCPGVGIGGHATIGGLGPSSRMWGATLDHVVEAKVVTANGTIVTASEAKYPDLFF
AIRGAAAGFGIVTQFVIKTVEKPKKTLHFTHRTPYTNSEGIVEQFKRWREMVADKKLDHR
IGTEFTLDPEGSKITATWFGTRQDFDQSGIAEKLGLKLTPVESSWVNTKRWQYENAVLTL
SDIPTEFFSRSLGFTADDATSFNATERLVQLIAANKSQSKLKWFCIFDATGGKVAEPAMD
STAYAHRDKVMFYQSYLYNIWAPLTAKEKGLLNGIHETIVGGISTRSPSTYPGYIDPLLE
NPQEAYWGPNLDRLEAIKREWDPEDVFQNPQSVRPAKLKL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	91	513	7.4e-77	0.9694323144104804

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.12e-23	92	231	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	1.86e-18	90	516	30	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	4.72e-11	470	514	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	3.49e-07	87	265	58	244	cytokinin dehydrogenase
178402	PLN02805	3.26e-04	91	267	133	312	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23960.1|AA7	7.92e-132	51	517	9	473
QUC19098.1|AA7	1.35e-129	51	516	9	471
CCA70426.1|AA7	1.31e-122	51	516	54	518
QRD00400.1|AA7	1.06e-114	83	517	37	476
AHG26149.1|AA7	3.61e-112	50	519	5	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	3.07e-70	25	518	3	497	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	1.72e-60	43	516	27	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
3RJ8_A	5.33e-60	76	517	21	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	1.45e-59	84	515	35	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6Y0R_AAA	3.09e-59	84	515	53	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.85e-77	49	515	5	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.58e-69	25	518	3	497	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	4.49e-59	52	517	22	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	6.84e-59	84	515	54	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.59e-58	84	515	53	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.755095	0.244929

TMHMM  Annotations     

There is no transmembrane helices in FOYG_14824-t42_1-p1.