CAZyme Information: FOYG_14601-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_14601-t42_1-p1
• CAZy Family: GT2
• CAZyme Description: heme-binding peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		36448.57	4.9257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:1129062-1130110(+)

Full Sequence      

MSSIDKPLSESQASRPGDFEAVRKSIIDLLRQPDYDDGSAGPVLVRLAWHSSGTYDVETD
TGGSNGAGMRYEAEGGDPANAGLQNARLFLEPVKRLHPWITYSDLWTLAGVTAIRAMGGP
EIDWLPGRTDFVDDSKLPPRGRLPDAAQGADHIRDIFYRMGFNDREIVALSGAHSLGRCH
TENSGFEGKWVNNPTRFSNQYFRLLLSEKWTEKTVPESGVTQFSSVDPDTEEELMMLPTD
MALTTDPEFSKYVRLYADDKELFFNDFKAAFAKLLELGIARDAEGNITNSDNEKGGYRSA
PKKSDSVSTNAGFGHGTKTNGCPVMHARAKL

Enzyme Prediction     

No EC number prediction in FOYG_14601-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	35	278	4.1e-58	0.9294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	6.12e-138	11	282	5	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	1.33e-87	39	278	29	243	L-ascorbate peroxidase
178467	PLN02879	1.56e-74	41	280	34	248	L-ascorbate peroxidase
166005	PLN02364	1.93e-66	39	278	31	246	L-ascorbate peroxidase 1
223453	KatG	3.72e-63	18	279	68	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61761.1|AA2	2.89e-248	1	331	1	331
QGI94677.1|AA2	4.23e-241	1	331	1	331
QGI63795.1|AA2	4.23e-241	1	331	1	331
QGI81067.1|AA2	4.93e-240	1	331	1	331
CZS79349.1|AA2	1.49e-209	1	331	1	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	5.34e-79	18	279	18	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	1.21e-77	18	279	18	274	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
1STQ_A	3.43e-77	18	279	18	274	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
4NFG_A	9.71e-77	18	279	18	274	K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex [Saccharomyces cerevisiae]
1S6V_A	9.71e-77	18	279	18	274	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],1S6V_C Chain C, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2N18_A Dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HWQ2|CCPR2_GIBZE	1.87e-210	1	331	1	331	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	5.30e-168	13	309	2	298	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1
sp|Q5B1Z0|CCPR2_EMENI	1.65e-160	14	305	2	295	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1
sp|Q4WLG9|CCPR2_ASPFU	3.01e-156	14	305	2	295	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1
sp|Q4PD66|CCPR2_USTMA	6.34e-141	14	304	2	295	Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_14601-t42_1-p1.