CAZyme Information: FOYG_14502-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_14502-t42_1-p1
• CAZy Family: GT15
• CAZyme Description: alpha-L-fucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	JH717848.1|CGC4	67190.08	5.0030

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:912876-914705(+)

Full Sequence      

MMTLSTKLTAVAAAAGALFPINAAAQASGPYEATWESTDKHNASPEWFRDAKFGVYWHWG
AFTTPQYASEWYPRNMYEPGSDQRKHHTETYGPPEEWGYANFINGADDLKGNFVQFKPVL
SSKGGEFDPEAIIKAVKASGAKFAGPVGEHHDGYSMWDSKVNEWNSVKRGPKLDLVKLWA
DLVRKNGMKLVVAMHQAYNYNGFYEWAPKTNDTSLKKLLGQLSRDESDQLWFDKHREMLD
HVQPDIIWNDFSLDSPGYCADFDGPCAVAEKKRLEFLAYYFNRAVEWNKEVVTTHKHFDV
GFRDTSTVSDYERGGPANITRPYWLTDDAISASSWSYTVGIKYYSSKAMVHSLLDRISKN
GNMLLNISPTAVGVLPDEQLKVLQDIGDFLGRYGESVFSTRAWDIYGEGPNQVTGGSFTA
PLQGNSSDIRFTRNKDADVLYATVLGWPDDKHVSISSLGSDALVDLEDLKSIELLGDKAG
EYEKVLDWKQSKDALEISLPAQPAESLAYVLKLTFDGGIPVPQPKIGASVFSATSATGRG
VSLGLGDFNEEFLTEAGLKPDAVRFIRVSSGTKLTVYSAGDLSGDSKELDAGEHKVDEGS
VGSIAISKA

Enzyme Prediction     

EC	3.2.1.51:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	22	398	3.7e-87	0.9421965317919075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	1.65e-125	25	458	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	9.50e-122	26	395	1	333	Alpha-L-fucosidase.
226195	AfuC	2.48e-53	58	452	1	374	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
407025	Fucosidase_C	8.37e-11	428	514	8	90	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EWY82402.1|GH29	0.0	1	609	1	609
EXK36330.1|GH29	0.0	1	609	1	609
EXL52301.1|GH29	0.0	1	609	1	609
EXL73351.1|GH29	0.0	1	609	1	609
EWZ30974.1|GH29	0.0	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NI3_A	0.0	25	608	1	584	Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
7LJJ_A	2.76e-85	31	517	43	512	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.49e-84	31	517	43	512	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
1HL8_A	9.02e-43	31	462	8	405	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	1.24e-42	31	462	8	405	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	3.30e-32	16	514	14	459	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q99KR8|FUCO2_MOUSE	3.73e-31	31	500	28	440	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
sp|Q9VTJ4|FUCO_DROME	3.42e-30	25	461	25	421	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
sp|Q5RFI5|FUCO2_PONAB	6.00e-30	31	448	32	401	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
sp|Q6AYS4|FUCO2_RAT	2.52e-29	31	500	26	438	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000401	0.999561	CS pos: 25-26. Pr: 0.9683

TMHMM  Annotations     

There is no transmembrane helices in FOYG_14502-t42_1-p1.