CAZyme Information: FOYG_14472-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_14472-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703		78443.35	6.8930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:852485-855521(+)

Full Sequence      

MFARLLLFTTLLAVSLAYFLSRETSTEHAPYVQGRNKTVLFLTNSEHGLSNVHLATASAI
LENYPDVEVYFASFSSIEQKLERVSSFAKIKSPHARAIVFHGLTGLTFVQAIAKEGRSFI
SPPGWRGIATLAEHTQLWISPWTFEDHVYLYKELGSIINEVDPAVIVLDSWFRPAIDATR
KRNRQHAFITPNTLVDHFLGIQPLWTRLWKYPAPSSGFLSPVPLVNIPENVYMNIRYIYS
AMFTPDASKKKARLQEIGLGEPMNLFGMNRLGVPWITQNTQGAMIPVEVIPPNVTYAGPI
ILSGPPAHQQDPETATWLKNAPTVLINLGSNLAYDESRAEVMAIAIAALLSSTNYQVLWK
FNKLGDFSDDFLVHLKPYLDNKRLKMPSWLVTDPSSLLDTGNIVTSVHHGGSNCYHEALA
AGVTQVILPLWADLYNYAALAETSGIGVWGCKDSTPNWMTFFAIVASAMPDPKGHEFRAA
GPYDSRSPCPGLNALANHGYLPRDGANINYDMINHAAQAAYHFEDGFYIDAVNMVFQLDI
STTSRPNETFHLRDLAQHDQIEVDGSLTRNDIFFGDDLHFDATVFDPVARDLGLDKISRK
DKFVTIETAAKATKNRLDLAKRVNPEFNVSVHQHETEYGTTALYLLTLWDEHQKAAPKHW
VKALLGEDRIAYREGYNKGKSVKTNKQVGGMTQAVRAVVGWKP

Enzyme Prediction     

No EC number prediction in FOYG_14472-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396065	Peroxidase_2	1.99e-53	475	670	1	177	Peroxidase, family 2. The peroxidases in this family do not have similarity to other peroxidases.
340817	GT1_Gtf-like	3.92e-14	95	453	21	358	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
223071	egt	6.56e-05	290	448	263	410	ecdysteroid UDP-glucosyltransferase; Provisional
224732	YjiC	1.32e-04	407	449	305	347	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	0.009	324	448	278	386	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61647.1|GT1	0.0	1	460	1	460
UPK94308.1|GT1	6.88e-184	1	458	1	459
CEI41903.1|GT1	5.92e-179	1	458	1	459
CZS74954.1|GT1	1.53e-176	6	458	4	459
CEF84524.1|GT1	1.53e-176	6	458	4	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ZBP_A	1.22e-29	471	703	3	226	Chain A, Marasmius rotula UPO [Marasmius rotula],7ZBP_B Chain B, Marasmius rotula UPO [Marasmius rotula],7ZBP_C Chain C, Marasmius rotula UPO [Marasmius rotula],7ZBP_D Chain D, Marasmius rotula UPO [Marasmius rotula]
5FUK_A	1.47e-29	475	703	3	222	Crystallization of a dimeric heme peroxygenase from the fungus Marasmius rotula [Marasmius rotula],5FUK_B Crystallization of a dimeric heme peroxygenase from the fungus Marasmius rotula [Marasmius rotula]
5FUJ_A	1.55e-29	475	703	3	222	Crystallization of a dimeric heme peroxygenase from the fungus Marasmius rotula [Marasmius rotula],5FUJ_B Crystallization of a dimeric heme peroxygenase from the fungus Marasmius rotula [Marasmius rotula]
7ZCL_A	1.04e-28	476	681	5	202	Chain A, Collariella virescens UPO [Achaetomiella virescens]
7ZCL_B	1.07e-28	476	681	6	203	Chain B, Collariella virescens UPO [Achaetomiella virescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	1.03e-60	34	457	3	424	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	2.28e-59	32	453	1	435	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|Q00668|STCC_EMENI	6.50e-18	460	678	16	225	Peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcC PE=2 SV=2
sp|B9W4V8|APO1_COPRA	5.70e-12	475	642	22	198	Aromatic peroxygenase (Fragments) OS=Coprinellus radians OX=71721 GN=APO PE=1 SV=2
sp|P04963|PRXC_LEPFU	6.41e-07	479	603	40	169	Chloroperoxidase OS=Leptoxyphium fumago OX=5474 GN=CPO PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.159762	0.840196	CS pos: 17-18. Pr: 0.7813

TMHMM  Annotations     

There is no transmembrane helices in FOYG_14472-t42_1-p1.