CAZyme Information: FOYG_14361-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_14361-t42_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	JH717848.1|CGC19	32036.73	6.8614

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717848.1:638084-639002(-)

Full Sequence      

MRLTSFFQSAALVVASLSELSQAHAFTPRGFTTPKRKELWQPEVGTPWQIILSEVVKVPK
AGVSSMTPDVPIWDMDLFENSKSTIAAMKKGGKKVICYFSAGSWENWRKDKDSFPKKDLG
KVMDGWPDERWVNISSVAVRAIMAQRIKLAAEKGCDAVDPDNMDGYQNDNGLGLTEGDTI
SYVKFLSTEAAKYNMVIGMKNGGDVTEEVLPYVAFCINESCIQYSECDLYQPYIDAGKPV
FNIEYPKGAPKVKAKDQKKICSTSGAAEGSDGFSKVIKNMNLDKWVLYC

Enzyme Prediction     

No EC number prediction in FOYG_14361-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	48	245	1.8e-73	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	4.71e-113	48	283	2	220	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.29e-33	17	245	37	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.49e-05	81	245	62	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61554.1|GH114	6.05e-213	1	289	1	289
CZS85814.1|GH114	8.19e-157	1	289	1	283
CEF86455.1|GH114	8.19e-157	1	289	1	283
QPC80209.1|GH114	1.16e-156	1	289	1	283
CEI70516.1|GH114	1.41e-154	1	289	1	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	3.11e-89	28	289	25	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	5.40e-89	28	289	42	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FOYG_14361-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999709	CS pos: 25-26. Pr: 0.8154

TMHMM  Annotations     

There is no transmembrane helices in FOYG_14361-t42_1-p1.