CAZyme Information: FOYG_13472-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_13472-t42_1-p1
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		71543.92	8.9081

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717847.1:1174401-1176807(-)

Full Sequence      

MFSSANAWNHQWHVLFWDRLSSSSHQFSYRYSLISQVDPLENTNIHSLSFILIMPRFQAL
TLAALSCLHATTASAYPRQGASVRTEYDYIIVGAGASGLTVANRLSEDPAVTVLVIEAGD
FDKNEDIVTIPGLAGGAVGTKYDWNLTYPATTSLNGRNVSIPLGKVVGGSTKLNRMVYDR
GSKADYDRWAELGNSDWQWDTLLPYFKKNEKFTGPTADIKKEYSITTDPSAHGSSGFIHS
SYSPFFWPTTKNLVKATGELDINIAFDQANGGAVGGYFCPHNLNPKTLVRSSAQDYYSAV
SQRKNLQLLPGNQVTRILTSKNGSSVRATGVEFAKNKDSAKKTVKAKKEVILAAGAIHTP
QILQVSGIGDSALLSSIDVPVVVDLPAVGQNFHDHVLLAVVGTINAPIQTGNLTSNATFA
AEARAEYDQQKKGPYTSPTGDFLLFLPLSNYTSSASDIHKQATSQDGSKFLPSGTPTEVV
KGYKKQQKVLNEKLLDTKSAILEIIWADGTSVLGLQHPYSRGSVKAKSSNIFDYPDANPE
FLKNPLDIAILTEGVKFVRKLSGAPSIKTLNPFEIVPGANVTSDSDIEQFIRSSASTLFH
PAGSCKLGSRSDGGVVDEKLRVYGIKGLRIVDASVIPLLPATHTMTTVYAVAEKAADLIK
RG

Enzyme Prediction     

No EC number prediction in FOYG_13472-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	86	660	1.4e-189	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.20e-111	86	661	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.74e-104	86	662	5	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.81e-44	518	655	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.12e-35	150	395	10	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.93e-27	73	648	37	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60653.1|AA3_2	0.0	54	662	1	609
QGJ00970.1|AA3_2	0.0	54	662	1	609
CCT74664.1|AA3_2	0.0	54	662	1	609
QGI70079.1|AA3_2	0.0	54	662	1	609
QGI87441.1|AA3_2	0.0	54	662	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	3.11e-111	82	661	1	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.68e-97	57	659	3	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	3.49e-83	86	660	1	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.91e-82	86	660	2	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.53e-80	86	661	40	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.54e-110	52	659	14	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.54e-110	52	659	14	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q5AUN2|XPTC_EMENI	1.77e-96	85	660	36	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.51e-88	59	661	3	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.29e-83	71	662	25	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000029

TMHMM  Annotations     

There is no transmembrane helices in FOYG_13472-t42_1-p1.