CAZyme Information: FOYG_12887-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_12887-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	JH717846.1|CGC8	60796.99	5.2076

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717846.1:2812896-2814831(+)

Full Sequence      

MFLSRWLVAVGLLCASVVKSLDLDTFTGQAQVLGRQREMILNQQQGDDTVKPMRMMAEPE
ADDSDGKCTKKKGCKLGCCGPLDKEGFGICGTGPKFCGKDCTSECDYKSECDPGGWGLKY
SNFTTCPLSVCCSDYGFCGTLSSYCKGKTVASPKCDKAKHSSDKRTIGYYEGWNYQRPCG
NMEPEDIPLGYYTHINFAFALVNPDTYRIDPMDKGTASRYGRGSVLKQQQKDLEVWIAIG
GWAMNDPGKYRTVFSDLAKSEMKQDAFFDSLITFLQRYDFDGVDLDWEYPVAEDRGGVEE
DFENYVNLLARLRKRLNSSGHKYGLTLTLPASYWYLKGFDIVNMEKYLDWFNIMTYDIHG
DWDENIESLGPYAHAHTNLTEIQQGLELLWRNNINPERVVMGLGFYGRSFTMKSANCLDA
GCEFSEGAKGGECTGTKGVLSASEINKIIKNGGKMKLDEKAAVQIVTWDSNQWVSWDDAK
TLKMKLDYANENCLGGTMVWAIDLDDGTLIEALGKGMKRKKSRISPPQKVVSCFGTGNID
KDEL

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	164	507	5.5e-74	0.9425675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	6.76e-87	165	505	1	334	Glyco_18 domain.
119357	GH18_zymocin_alpha	8.77e-84	165	505	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119351	GH18_chitolectin_chitotriosidase	2.28e-76	169	506	4	342	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	1.72e-75	165	505	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.06e-71	167	505	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN14642.1|CBM18|GH18	0.0	4	544	4	544
UPK94778.1|CBM18|GH18	1.20e-303	7	544	7	549
AEO68677.1|CBM18|GH18	1.11e-247	62	536	42	515
ABI48362.2|CBM18|GH18|3.2.1.14	1.01e-246	62	544	41	523
ABK27625.2|CBM18|GH18|3.2.1.14	1.01e-246	62	544	41	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUS_A	1.96e-48	163	506	1	343	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WUP_A	4.18e-48	156	506	85	439	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	2.65e-47	163	506	1	343	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
5WV8_A	5.61e-47	156	506	85	439	Crystal structure of a mutant insect group III chitinase (CAD1-E217L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVB_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)6 (CAD1-E217L-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5Y29_A	6.09e-47	161	506	4	352	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.01e-51	109	501	317	708	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36362|CHIT_MANSE	4.87e-41	162	506	21	376	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q6RY07|CHIA_RAT	4.73e-40	167	508	25	368	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	4.39e-39	158	508	16	368	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|Q9W5U2|CHI10_DROME	2.05e-38	162	506	963	1311	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000214	0.999761	CS pos: 20-21. Pr: 0.9649

TMHMM  Annotations     

There is no transmembrane helices in FOYG_12887-t42_1-p1.