CAZyme Information: FOYG_12789-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_12789-t42_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		33826.85	4.6296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717846.1:2564182-2565242(+)

Full Sequence      

MKASLLLSLLPVAQAAVIDTRQSKTGDGKQGDTDATQGDLSQRPPPRFPFPVTKFPVAKE
TVVLKNAKYIMPGEVFDGKMKRYERPEGSCNEQAEGTDADAVFNLLPGSTIRNVIIGKNQ
AEGIHALGDAWVENVWWEDVCEDALTSKGLNTQLRVIGGGARSATDKIFQDNSLGGKYNI
TGFYAEGFGTFYQSCGNCLNQAKRNATIQNVIAVDGLRMGIINPNYGDEFRLKNAQIDNV
TSIVDKEIGNNVQTVPYYIGNGPDEKYALYNETRDNITKFKGKVTNAYEPEDPYEWLEEF
WPEGFN

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	59	246	6e-72	0.9742268041237113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.67e-79	53	249	2	195	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59972.1|PL3_2	1.83e-202	1	306	1	306
CCT73830.1|PL3_2	1.23e-200	1	306	1	306
QGI69447.1|PL3_2	1.23e-200	1	306	1	306
QGJ00336.1|PL3_2	1.23e-200	1	306	1	306
QGI86805.1|PL3_2	1.44e-199	1	306	1	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	8.11e-21	61	243	3	180	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	7.14e-17	62	197	8	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	7.28e-17	62	197	9	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	5.87e-16	62	197	17	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4YZ0_A	5.87e-16	62	197	17	148	C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4YZ0_B C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1D5E3|PLYF_NEOFI	1.36e-47	70	238	40	209	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|Q0CCF8|PLYF_ASPTN	3.82e-47	59	238	27	209	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	4.01e-47	60	272	44	255	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|B0YB89|PLYD_ASPFC	1.05e-45	59	265	26	231	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	1.05e-45	59	265	26	231	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000748	0.999258	CS pos: 15-16. Pr: 0.9536

TMHMM  Annotations     

There is no transmembrane helices in FOYG_12789-t42_1-p1.