CAZyme Information: FOYG_12786-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_12786-t42_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	JH717846.1|CGC11	61471.13	6.9646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717846.1:2556723-2558510(-)

Full Sequence      

MQRSVQKAIIWLGAIFITYHVFSLLFSRRASQPSHSDPNLQKAPAKLKGDPLRAKAIVEA
FRFSWNKYEEFAAPHDTLLPINKTFEDDRNGWGATAVDALSTAIIMEDAEIVDKILRQIM
LTDFTVTVVPDQPISLFETTIRYLGGLLSAYDLLSGSYKHLCTDMYLRNNLLKAAVILAD
RLSVAFDTPSGIPDDEIIFNPQLRRFGNIDNSITCFGTLVLEWTRLSDLTGNQTYAKLAQ
RAQGHLIHPKTKQSFTLPGLIGTYVKLKDGYFGDYQAGWGGGSDSYYEYLIKMYAYDSVA
FAEYGESWIQAAESSMLYLASSPSTRPDLTFLGEMRGNTMIPISSHLASVCGGSLILGGL
LLQNQTFVDFGVKLSESYYEVYRQSPSGIGPELFRWVDDGRQPLAKASSKRLPAPKWQSF
YEKSGYYHTNAEYILRPETIESLYYAYRATGDRKYQDWAWEAFEALNRMCKVEGGYTGLK
SVMKTKDDKTRKFVDKMESFWLAETLKYLYLMFAEDSELQVRSDGKMKYVLNTEAHPLLV
RGK

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	60	539	3.7e-128	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.30e-168	60	540	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	9.34e-106	53	540	72	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59969.1|GH47	0.0	1	543	1	539
QGJ00339.1|GH47	0.0	1	543	1	543
QGI69450.1|GH47	0.0	1	543	1	543
QGI86808.1|GH47	0.0	1	543	1	543
CCT73833.1|GH47	0.0	1	543	1	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HCU_A	2.26e-172	50	541	12	493	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1KKT_A	7.18e-144	21	540	11	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	1.43e-142	53	540	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1X9D_A	1.19e-65	2	538	41	532	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
5KIJ_A	3.52e-63	53	538	5	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	5.71e-147	53	541	39	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	3.69e-143	21	540	11	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|A2QAS2|MNS1B_ASPNC	5.57e-143	20	540	2	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|B8N417|MNS1B_ASPFN	1.01e-142	45	540	32	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	1.01e-142	45	540	32	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

Start	End
7	26