CAZyme Information: FOYG_11941-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_11941-t42_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	JH717846.1|CGC15	41965.51	6.9334

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717846.1:340645-341854(-)

Full Sequence      

MTRKNVMHGVFLRPSRRVRVFAFLFFFVAATWTFTIKSRSTCSVEEDIARDYPLIYRHVH
SFNGTGGAWHIPPYWADMHTKQPHNILDAARIASKAALSKRERQMPFSNIPLLVHQTWKK
TAADSWNPRILPWVELWLEDSIYVDRGPSMAYLFWDDTGMRALVEEFENDFLERYDTLLT
PVERSDVFRILVCKHFGGIYGDLDTELIQHPATWISGSDMATWTDPKTGKAYGYYNTSVT
PDYETPVVSLLWGLEADNDPESDAYWRQSYTYPQQLSQWAFAAAPQHPVFGRYMDNLRNY
TKNNEPTAQNSDPLKRTGPAAVTLATKSWLEDHVGFRWASLTGLKDGGKSKLVHDILILP
ITGFQ

Enzyme Prediction     

No EC number prediction in FOYG_11941-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.97e-15	110	306	82	249	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.54e-09	148	219	16	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73207.1|GT32	2.43e-235	1	365	1	363
QKD59215.1|GT32	1.03e-219	78	365	1	288
QPC63324.1|GT32	4.08e-201	1	365	1	365
CEF84399.1|GT32	2.98e-192	24	365	7	348
CZS74875.1|GT32	2.00e-190	24	365	7	348

PDB Hits     

FOYG_11941-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	1.50e-09	110	234	57	178	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	1.63e-07	104	303	56	199	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P31755|OCH1_YEAST	3.55e-07	82	297	76	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.92e-07	110	204	55	140	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.970636	0.029385

TMHMM  Annotations     

Start	End
20	36