CAZyme Information: FOYG_11785-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_11785-t42_1-p1
• CAZy Family: GH37
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649	JH717845.1|CGC4	69633.15	5.3863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717845.1:3353911-3355860(-)

Full Sequence      

MRPTNILAAVSAVASVVGAVDLTGYEYVVVGSGAGGGPLAARLALAGHKTLLIDAGDDQG
QSLNYTVPAYSARASEDQDIAWNFFVRHYADDKRQAQDYKTTYETPDGGEYTGLDPPKGS
TIKGTLYPRTATIGGCTAHNALIALYPWKSDFEYIASLTGDTSWSADNMRKYFVRLEDNN
YLLPGKPGHGYNGWLSTETAPLSIALQDPQLLSLITGGAFALGNLTDNIINVATLLAGDA
NADTDGRDAKGGFFQAPIHSKNGIRVGPREFILAVRDAKDSKGNKKYPLDVRMNCHVTKV
VFDESEDPPRATGVEFLDGRGIYKASPLSRSAGAGKPGSATASREVIVAGGTYNSPQILK
LSGIGPADELKKFKIPVISDLPGVGTNLQDHYEIVVQSRIPKNFSALHGCTFDGGPEDKC
LDQWQKPLLGLTVNKGTYTSSGLPVAMLYKSTAADRGDWDIFAFGGPVNFRGYFPNYSYN
ATAEHDIFSWAILKGQPRNHAGTVTLKSDDPLDVPEIVYNYFDTGDDGYEKDIQALAEAV
DLTRDAFGRQIIPTKEVLPGASVSTKGEVEDYIKNTAWGHHASCTCPIGAADDEMAVLDS
KFRVRGVKGLRVVDASVYPRIPGTFTAVSTFIVAEKAADDILSGLSRLS

Enzyme Prediction     

No EC number prediction in FOYG_11785-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	642	1.4e-91	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.35e-68	128	642	83	532	choline dehydrogenase; Validated
225186	BetA	1.13e-57	39	643	22	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.95e-31	502	637	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.66e-17	289	624	235	559	Protein HOTHEAD
366272	GMC_oxred_N	1.58e-15	125	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57933.1|AA3	0.0	1	649	1	649
UPK92349.1|AA3	0.0	1	646	1	646
QMW33146.1|AA3	0.0	19	646	19	646
QRD84722.1|AA3	0.0	19	646	19	646
QMW45179.1|AA3	0.0	19	646	19	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.06e-37	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.43e-37	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.43e-37	25	638	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.43e-37	25	638	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.69e-37	25	638	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	2.29e-46	25	642	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.51e-45	25	642	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	1.35e-43	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	1.35e-43	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|Q8ZGW0|BETA_YERPE	1.35e-43	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.085691	0.914283	CS pos: 19-20. Pr: 0.7706

TMHMM  Annotations     

There is no transmembrane helices in FOYG_11785-t42_1-p1.