CAZyme Information: FOYG_11301-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_11301-t42_1-p1
• CAZy Family: GH33
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		37370.88	5.1046

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717845.1:2184111-2185268(-)

Full Sequence      

MNKGQDIADKNFQAHWKRWINQTDLDEMLSYGLNTIRVPLGYWLKEDLVDDSEHFPKGGL
EYLTQLCGWASDRGFYIILDLHGAPGAQEPNQPFTGQYAPTVGFYSDYNYGRAIEWLEWM
TDIIHTKKEYRNVGMLGLVNEPLNWDKAVDSLRKTYYPKACSAIRKVEDKLKVISNNRLH
IHMMGSLWGSGKPTEFLRNTSFTAFDDHRYLKWDTSVEASHDAYIKKCCSDDRNTDGPTI
VGEWSLAVPDDVEKTDAWNPQTQKEFYTKWFSAQVHAYEENTLGWVFWTCKASLGDDYRW
SYRVVDAARAGVIPEDLDSLPSVC

Enzyme Prediction     

No EC number prediction in FOYG_11301-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	4	303	9.8e-148	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.77e-17	2	324	56	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.22e-06	6	289	2	267	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93324.1|GH5_15	7.77e-214	1	324	93	414
QKD58348.1|GH5_15	3.68e-202	28	324	1	277
CCT71223.1|GH5_15	1.42e-153	10	303	83	324
QGI66947.1|GH5_15	1.42e-153	10	303	83	324
QGI97833.1|GH5_15	1.42e-153	10	303	83	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.19e-20	4	305	53	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	3.14e-20	4	305	58	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	4.11e-20	4	305	53	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.31e-20	4	305	59	378	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	4.31e-20	4	305	59	378	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	8.97e-141	1	320	87	403	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|Q0C8Z0|EXGB_ASPTN	2.49e-139	4	319	84	396	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	8.81e-139	4	320	81	393	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	2.95e-131	4	303	81	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	3.40e-130	4	303	81	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_11301-t42_1-p1.