CAZyme Information: FOYG_09142-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_09142-t42_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		60789.14	7.6062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717844.1:274966-276645(-)

Full Sequence      

MTPPNPPRKVLMVVTVGGYTHAAPVLELGKVLAQRGHVVDFATLEGQESWTKGYEYISQL
HLMGPGPSNEELEAHYLRMREWDASKGFAGVMDSKYLFDSYWTQTYQHLKRIVDDPATKP
DMMVADFFVDAVKDILYQYNIPIAMVYPQMPALMCPCSYIPGQPGFQIEGTLTSENASMW
LRFRNELVIYKALPSIIKWVKWTKKMRQDAGVNYKLPTPSKPNYLVLINSFFGLEVPKDI
PPLVQAVGPILADTYPPLSEPYESFLGNHKKTLYLALGTHIILSNGHAAKLVQGLVAAID
QGLIDGVIWSISEAARRDVDPSLHFTDKGGKAFTFASLFNGEHPTFLITTFAPQRAILDH
DHTAIYLTHGGGSSANEGLYHGKPMLAMGFFFDQISNVPRLVASGTSEALDKFRFTPEEV
CQKIKLLSEDKDGSYQRNCIRMQRIARAASRRKELGADLIEEVMYDTEGRFDGKKELRPM
HLQTADMRMSQFKAKNWDLWLVGLFTLGLVPLASITIGKWAWTEKRAIGDWAGETVKKWM
G

Enzyme Prediction     

No EC number prediction in FOYG_09142-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	92	450	1.1e-23	0.7722513089005235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.42e-40	9	462	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.93e-18	12	464	5	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	3.47e-14	227	479	230	451	UDP-glucoronosyl and UDP-glucosyl transferase.
178572	PLN02992	5.72e-07	226	426	204	417	coniferyl-alcohol glucosyltransferase
178589	PLN03015	7.23e-06	346	433	337	431	UDP-glucosyl transferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56593.1|GT1	0.0	1	541	1	541
CAK46937.1|GT1	4.08e-239	6	538	9	524
QKX59607.1|GT1	1.56e-233	5	528	7	533
QLI65751.1|GT1	1.71e-233	7	533	5	531
BCR88254.1|GT1	1.77e-217	5	525	6	530

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	8.97e-10	339	445	80	189	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	8.90e-09	339	430	59	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	1.30e-08	339	445	58	167	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7Q3S_A	1.94e-07	226	451	215	460	Chain A, Glycosyltransferase [Zea mays]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36514|UD2C1_RABIT	1.46e-12	117	445	115	421	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|P36513|UDB14_RABIT	1.12e-11	199	445	224	449	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|P06133|UD2B4_HUMAN	1.95e-11	153	445	187	448	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|P36537|UDB10_HUMAN	3.42e-11	121	445	145	447	UDP-glucuronosyltransferase 2B10 OS=Homo sapiens OX=9606 GN=UGT2B10 PE=1 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	4.49e-11	225	431	246	431	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
496	518