CAZyme Information: FOYG_08834-t42_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_08834-t42_2-p1
• CAZy Family: GH18
• CAZyme Description: endoglucanase type K

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		44577.99	8.5436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717843.1:3924175-3925492(-)

Full Sequence      

MRCASRYSGCWTLLHCPLIHSLHSFFRITYTLFQNSHSLNKPTFATMRSYTLLALAGPLA
VSAASGSGHSTRYWDCCKPSCSWSGKAAVNAPALTCDKNDNPISNTNAVNGCEGGGSAYA
CTNYSPWAVNDELAYGFAATKISGGSEASWCCACYALTFTSGPVKGKKMIVQSTNTGGDL
GDNHFDLMMPGGGVGIFDGCTSEFGKALGGAQYGGISSRSECDSFPELLKDGCHWRFDWF
ENADNPDFTFEQVQCPKALLDISGCKRDDDSSFPAYKGDTSASKPQPSSSAKKTTSAAAA
AQPQKTKDSAPVVQKSSTKAAAQPEPTKPAVKPQTDKPAATKPAATKPAQPVNKPKTTQK
VRGTKTRGSCPAKTDPTSKASVVPAYYQCGGSKSAYPNGNLACATGSKCVKQNEYYSQCI
PN

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	68	266	4e-87	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	2.26e-119	67	266	1	214	Glycosyl hydrolase family 45.
197593	fCBD	7.56e-07	384	420	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
225629	FtsN	1.34e-04	284	366	108	190	Cell division protein FtsN [Cell cycle control, cell division, chromosome partitioning].
395595	CBM_1	1.83e-04	385	416	1	29	Fungal cellulose binding domain.
237030	kgd	2.08e-04	278	363	37	122	multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55086.1|CBM1|GH45	8.53e-262	47	422	1	376
AAA65589.1|CBM1|GH45	3.54e-254	47	422	1	376
AAN23441.1|CBM1|GH45	1.13e-250	47	422	1	376
AAO30278.1|CBM1|GH45	6.52e-250	47	422	1	376
CCT69059.1|CBM1|GH45	2.25e-249	47	422	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.05e-122	47	276	1	232	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	1.29e-113	64	276	1	211	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.49e-113	64	276	4	214	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1OA7_A	5.36e-108	67	277	2	210	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1L8F_A	4.82e-107	67	273	2	206	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	6.28e-255	47	422	1	376	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	3.50e-105	68	277	3	211	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	1.18e-79	47	267	1	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	1.98e-57	65	265	37	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	1.16e-41	52	278	9	247	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999701	0.000305

TMHMM  Annotations     

There is no transmembrane helices in FOYG_08834-t42_2-p1.