CAZyme Information: FOYG_07365-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_07365-t42_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	JH717842.1|CGC15	35513.00	4.4627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717842.1:4529286-4530351(-)

Full Sequence      

MVTFNRIALTVLAVGGSAVEAKPAAADSSTLFELSDFKPGVEWEIVLHQPIKHDTVADLI
PSKAKVWDIDMGHGRDYPEMIPLLKGAGKFVICYFNAGALQSWDKDIKQFPKAVIGHSLA
YPYDSEEWYLDIRDSTVLKLQKARLDVAAKIGCDAVDPDNVDAWQQDGEDPTGFKLKPSD
YTKYLKNLAEYAHSIKTKDGNRLLVGQKNAPEIAEDLVSTLDFAVLESCRGTTDPDEENW
PFCEDFQTYIDAGKPVLQIEYPPSVEKTGKLSSSDNTYYCTPKDEDKGFSKILKWASAQL
DGWGQFCGEDPFRTPVINE

Enzyme Prediction     

No EC number prediction in FOYG_07365-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	43	261	3.2e-50	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	4.82e-68	43	294	2	215	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.28e-11	47	265	61	270	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	2.71e-06	78	261	63	251	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47958.1|GH114	7.02e-243	1	319	1	319
QGI89288.1|GH114	4.41e-234	1	319	1	335
QGI58377.1|GH114	4.41e-234	1	319	1	335
CCT61950.1|GH114	4.41e-234	1	319	1	335
QGI75595.1|GH114	4.41e-234	1	319	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	3.77e-30	40	307	39	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	5.39e-30	40	307	56	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FOYG_07365-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000307	0.999675	CS pos: 21-22. Pr: 0.9816

TMHMM  Annotations     

There is no transmembrane helices in FOYG_07365-t42_1-p1.