CAZyme Information: FOYG_07270-t42_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_07270-t42_3-p1
• CAZy Family: GH154
• CAZyme Description: chitin synthase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1205		135208.44	8.8607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717842.1:4227433-4231152(-)

Full Sequence      

MSLPERPGASPSYNQRNVYRNSPSRRSRPVDIETGGYHAVDNTAQHQQSMPLSPTSPDGH
SHRAGPEQPISRKRSLIRPERNRIDRDHRNYHYHKHAAHMNVLPSSTGNDPIYEDFEAST
DRSNSNLNDGGSDSSPRQRRNVSGEQEKGAAVASTMPTPDRKKSGKIKKRSKRHSKPPKR
IEEQLRPPTFWNVYCAIVTFWAPGFIMKCCGMPTRAQQRAWREKMGLISIILVIMAIVGF
LTFGFTATVCGAPAERLRVNKVDGGNMIFHGVAYDLSKSHHPPAQGMPLRSDGRGPNVLY
DLPEKHGGQDGSFLFQNVNGRCKGLITLAKDSDVPTNKDGDLAWYFPCTTFNQDGSSKVN
LTTPYYSGYGCHTTLNSRNAFYLDLSGSADVYFTWDDIKNSSRNLIVYSGNVLDLDLLRW
FNMSQVNIPKRFEVLRDKDSEVNKAIRGRDVTRMFQSSSDKKYAECFEEIIKVGSVDTET
IGCIASKIVLYCALVLILSVVGVRFLLAIIFQWFLCRKYAPTKTSQSSDRRKRNKQIEDW
SEDIYRAPVRLPGDVGSTVYGSSDRTSKRGSFLPTTSRFSSVGGPDVRASTGRRMPTTMA
SQGASNQLLTPGSIFKQGNDSRASFLRSDPYSSTPTDGPGPAGFIHDAVVPQPPSDWMPF
GFPLAHTMCLVTAYSEGEEGIRTTLDSIATTDYPNSHKVIVVICDGIIKGKGETMSTPDV
CLGMLKDHSIPPDMVEPFSYVAVASGSKRHNMAKIYCGFYDYGRNSRIPADRQQRVPMMV
VVKCGTPDEATKSKPGNRGKRDSQIILMSFLQKVMFDERMTELEYEMFNGLWKVTGISPD
YYEIILMVDADTKVFPDSLTHMISAMVKDPEIMGLCGETKIANKRDSWVTAIQVFEYFVS
HHLAKSFESVFGGVTCLPGCFCMYRIKAPKGGHNYWVPILANPDIVEHYSENVVETLHEK
NLYLLGEDRFLTTLMLRTFPKRKQVFIPQAVCKTTVPDEFMVLLSQRRRWINSTIHNLME
LVLVRDLCGTFCFSMQFIIFVELVGTLVLPAAIAFTFYVVITSIIHSPPQIIPLVLLGLI
LGLPGLLVVITAHSWSYIVWMLIYLLALPIWNFVLPTYAFWKFDDFSWGETRKTAGEKTK
KAGLEYEGEFDSSKITMKRWAEFERDKRSRSGYWGSRENVVGGGGGGSWTSPPGHQYNDE
YFSDA

Enzyme Prediction     

EC	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	643	1166	6.3e-293	0.9943074003795066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	0.0	641	1166	1	527	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	1.89e-104	669	1017	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
133045	CESA_like	6.95e-23	670	928	2	165	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.72e-17	842	1126	138	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	2.60e-11	844	1065	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD47866.1|GT2	0.0	1	1205	1	1223
AHG06595.1|GT2	0.0	1	1205	1	1222
QGI89367.1|GT2	0.0	1	1205	1	1221
CCT62022.1|GT2	0.0	1	1205	1	1221
QGI75675.1|GT2	0.0	1	1205	1	1221

PDB Hits     

FOYG_07270-t42_3-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78611|CHSD_EMENI	0.0	1	1170	1	1171	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4
sp|O13394|CHS5_USTMA	0.0	7	1172	114	1305	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3
sp|O13353|CHS4_MAGO7	0.0	1	1205	1	1229	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2
sp|J9VXM5|CHS3_CRYNH	0.0	20	1172	34	1200	Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS3 PE=1 SV=1
sp|P29465|CHS3_YEAST	0.0	72	1166	37	1151	Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

Start	End
189	206
227	249
493	515
1039	1061
1071	1090
1097	1119