CAZyme Information: FOYG_07213-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_07213-t42_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234		25783.17	5.9419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717842.1:4056333-4057145(+)

Full Sequence      

MWYSLLACLVSAAHASTLQPREDAAQIARNVSGFTAYDVLNYTKVDSDDSWKLQVPLRIL
CVGDSITEGWGSDANGGDGNGYRLSLAKHLSREKVVFAGTRHKGSMEDSYYAAWSGKTIQ
YISDHVTESLEQKPNLVLLHAGTNDMDLRPSISKEGNDPKDAATRLGDLIDKIVRYCPDA
VILVAIPLASCDTEKPKMPIYRALIPGLVRQRRKDGDHVIAVDFSTFDLGELRD

Enzyme Prediction     

No EC number prediction in FOYG_07213-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	57	227	1.3e-33	0.845360824742268

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	9.57e-35	57	227	1	128	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	4.05e-15	61	224	1	147	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.52e-09	59	224	1	150	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.24e-08	59	224	1	189	GDSL-like Lipase/Acylhydrolase.
238870	SGNH_hydrolase_like_1	1.98e-06	58	187	1	114	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC75718.1|CE0	2.03e-123	1	234	1	234
QPC66974.1|CE0	7.66e-121	1	234	1	251
UPK97767.1|CE0	2.51e-75	1	234	1	232
QPC73171.1|CE0	1.12e-71	39	234	30	226
CEF83009.1|CE0	4.64e-71	39	234	30	226

PDB Hits     

FOYG_07213-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOYG_07213-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999659	CS pos: 15-16. Pr: 0.9727

TMHMM  Annotations     

There is no transmembrane helices in FOYG_07213-t42_1-p1.