CAZyme Information: FOYG_05833-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_05833-t42_1-p1
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849	JH717842.1|CGC13	91495.34	7.6879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717842.1:272499-275308(+)

Full Sequence      

MSPTPDDGQSNRQTRYFELPANGEHSAPLPDELPPYEALAELEATTTGREDGRIDIDLSS
RIARRLSKLVPTGKPPLSYGQNQPPAYTETSERSIRLNIVIQVVGSRGDVQPFVALGTEL
QRHGHRVRLATHGQFDKFVRESGLEFFSIGGDPAELMAYMVKNPGLFPSMKTLRGGEIQR
KRKMVDEMLHKCWSSCIEPDELTGRPFVADAIIANPPSFAHIHCAQALGVPLHLMFTMPW
TSTREFCHPLANLKANGSDMSATAANYVSYSLVEWMTWQGLGDIINTWRGTIDLEPIPFS
EGPCLTETLGVPVTYCWSPALVPKPADWPENIDVCGFFFRDAPKYQPEPDLEQFLASGPP
PVYIGFGSIVIDDPEKLTATILEAVRATGTRAIVSRGWSKLGGDSAGDDQVFFLGDCPHE
WLFQHVTAVIHHGGAGTTACGLLNAKPTTIVPFFGDQPFWGNMVHAGGAGPAPIPFKSLN
SSNLAEAILFCLTPEASTAARQIADKMSREAGVRRAVASFHANLPLNNMRCDLLPNRSAA
WLYEKKGKKIKLSKMAAEILVEGEKVSWNNLKAYQPQPVHIENRRWDPLTATLATLATTG
VGMVTSASDIVVKPIQALRPVTPSGSRSASRDRSGDNSKRPSEEDVFGRPAGMDLPPAPT
GTKDKDPQHGALAAVKGSASGVGGFFKHYSKGMLLDLPYAVTEGMRNAPKLYGGKAYDPG
AVTDWKSGGIAAGKNFAHGMVEGIGGIVMEPVRGAKKEGAAGAAKGVGIGLLNLGTKVGS
GAIGLFALPGQGAYLSARALVKRKTGKSIMEARKIEGRDVVGRSDEVERQNDKTTVIEGF
ESLLTETKK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	122	520	1.2e-53	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	4.70e-83	97	522	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.56e-42	99	522	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.71e-23	99	246	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.40e-06	357	516	223	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46522.1|GT1	0.0	1	849	1	852
QGI59725.1|GT1	0.0	1	846	1	852
QGI76927.1|GT1	0.0	1	846	1	852
QGI90640.1|GT1	0.0	1	846	1	852
CCT63268.1|GT1	0.0	1	846	1	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GL5_A	1.10e-74	67	524	12	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
5XVM_A	1.73e-73	82	524	5	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
1IIR_A	1.28e-31	97	510	1	401	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.71e-29	97	488	1	350	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.00e-21	97	504	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	5.43e-130	49	525	111	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.86e-126	97	525	193	611	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|P0CN90|ATG26_CRYNJ	1.14e-74	42	536	973	1475	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	1.14e-74	42	536	973	1475	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	2.21e-74	97	539	1164	1624	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOYG_05833-t42_1-p1.