CAZyme Information: FOYG_04541-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_04541-t42_1-p1
• CAZy Family: GT69
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	JH717841.1|CGC19	66448.69	9.4208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717841.1:1313359-1315223(-)

Full Sequence      

MSMDGAVKTESPSLASAQLLVQDTSAEAISKTINSGFPVNTAFRLLLRTRRANTNGRNTV
AQRPFSTQNNYLAQSKVLVFNYGIHGFFERAQLLLRFEKEKKQPAPLRMGFSLQVAGPAA
IVSVVVLSIIIVIRLTGFAMLQYGRRRYPEPHGRLNFPKEISVILTIRDPNDPNLLDYVR
SILKNKPEQLFITTSDRKAQHRVDGKLTGLRFAYSATQISVGAENEPSRRREIAHALASV
STPRTVLTDQGVHWSSRFLELALIPFADSRVGCVTVPMIACKRDRIWGSFWTCLFSCYYG
LMAEKNRALNALDSSALFSGSPVLFRTKLAAQLRFKQQFEAEPCLNRWRGVHKADDYLFF
NRYLLQETVHEVPCLVVFQDTPDATVQVDRRSIAEFLSEYLQMTRNLWRLSRVMIRQRER
NHSFASFTLIYDILFVLLIHFTIYLDDDEWIAWGTFGSLLLIFQRVVGAQIVRRITANNY
GYDDCSTGTLLALLLVQLAYYILEVLRLVALATAWKADVELISEADIKARAGDPEALRYH
INGAEEARTEINEPPWISRCMELERPRRALRPLPDFPLFVIEE

Enzyme Prediction     

No EC number prediction in FOYG_04541-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	1.90e-16	160	416	1	234	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
404520	Glyco_tranf_2_3	2.52e-05	158	405	1	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53257.1|GT0	0.0	109	583	1	486
QGI78058.1|GT0	4.20e-237	109	583	1	486
QGI91772.1|GT0	4.20e-237	109	583	1	486
QGI60871.1|GT0	4.20e-237	109	583	1	486
CZS74529.1|GT0	1.14e-54	120	524	11	433

PDB Hits     

FOYG_04541-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F9WWD1|GT2_ZYMTI	1.86e-10	146	434	33	306	Type 2 glycosyltransferase OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) OX=336722 GN=GT2 PE=3 SV=1
sp|G4MWY1|GT2_MAGO7	1.03e-09	160	471	72	374	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
116	138
423	445
450	469
489	511