CAZyme Information: FOYG_04421-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_04421-t42_1-p1
• CAZy Family: CE16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		34351.47	9.6748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717841.1:1004304-1005290(-)

Full Sequence      

MKFLGLLNLAALVSAVPTPTFQEAGKTLGKRAAITDAANIGYATQNGGTTGGAGGATVTV
SSLAEFSKAAESEGKQVIYVKGQISGNNKIRVKSDKTIVGAAGASLDNIGLYINKQKNVI
VRNLKIKNVVAANGDAIGIQKSTNVWVDHCELSSDLSKDKDFFDGLLDVTHASDFVTVSN
THFHDHHKASLVGHSDNNGSEDKGTLHVTYANNHWSSIGSRAPSVRFGFVHVFNNYYEDI
SVTGVNSRMGAQVLVESTTFTSAKKALTSKDSKETGSISVNDVNLGGSTNDAPKGSISKS
NIPYQYSLVGSSKVKSAVVGVAGATLKL

Enzyme Prediction     

EC	4.2.2.2:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	80	260	1.6e-86	0.988950276243094

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.67e-66	84	264	6	190	Amb_all domain.
226384	PelB	9.28e-53	61	325	60	342	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.71e-43	88	260	28	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53360.1|PL1_7	5.86e-226	1	328	1	328
CCT64642.1|PL1_7	2.28e-223	1	328	1	328
QGI91872.1|PL1_7	2.28e-223	1	328	1	328
QGI78155.1|PL1_7	2.28e-223	1	328	1	328
QGI60971.1|PL1_7	2.28e-223	1	328	1	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.72e-40	41	260	6	246	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	1.34e-37	35	237	4	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3ZSC_A	5.87e-31	48	249	20	225	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]
1OOC_A	1.61e-29	33	238	8	258	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	1.10e-27	33	238	8	258	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59939|PLYB_COLGL	1.71e-118	7	326	14	329	Pectate lyase B OS=Colletotrichum gloeosporioides OX=474922 GN=PLB PE=3 SV=1
sp|B8NBC2|PLYB_ASPFN	8.94e-110	1	326	1	326	Probable pectate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyB PE=3 SV=1
sp|Q2TZY0|PLYB_ASPOR	8.94e-110	1	326	1	326	Probable pectate lyase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyB PE=3 SV=1
sp|Q0CBV0|PLYB_ASPTN	6.52e-107	1	326	1	325	Probable pectate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyB PE=3 SV=1
sp|Q00645|PLYB_EMENI	1.35e-106	1	326	1	326	Pectate lyase plyB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999695	CS pos: 31-32. Pr: 0.5205

TMHMM  Annotations     

There is no transmembrane helices in FOYG_04421-t42_1-p1.