CAZyme Information: FOYG_04169-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_04169-t42_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	JH717841.1|CGC7	57652.51	6.3991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717841.1:413367-414902(+)

Full Sequence      

MLTMPSLRLSAKSIQITAAIASIWLFVGVLYHYRDVSLYTPNNNFQSTSKPSSNSRSVES
IKLGARYFLDYSLKDEPKANFGELGQRTELLRSWIEELEGRDDSHETAELVGQILEKQFP
WLNSKQVVSPPLVDIYDRLGLSYNSKSVKSDKAPAGIVIPTGEKTLRFACHLVAALTRVH
KTTLPIQVVYAGDDDLSAVGRKKIQQAADGVEIEMLDVLTVFDDNTLKLADGGWAIKPFA
ALASRFEQVILLDADAVFFQDPRHLLLQNRFKETGVLLFHDRLLWKNGFADRQDWWHDQI
KHPGPETEKSLVWTERYSEEGDSGIVVVDKSRLDVLLGLLHIGWQNSERVRNEVTYKITY
GDKESWWIGFEATGSRYAFSPHYGGIVGWLGPTKAELDAAKKAEEEKKQEDNKRDDKEEV
RVCSFVIAHVDQNEKLLWYNGGLLKNKAVNQTEFEVPTHWMIDQKWHKGGSKQAMSCMVG
TKASALTSGEKAVLAKSIQVAKDMDETLHLV

Enzyme Prediction     

No EC number prediction in FOYG_04169-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	156	431	9.7e-47	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.91e-34	156	431	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD53586.1|GT71	0.0	1	511	1	511
CCT64876.1|GT71	0.0	1	511	1	511
QGI78376.1|GT71	0.0	1	511	1	511
QGI92097.1|GT71	0.0	1	511	1	511
QGI61198.1|GT71	0.0	1	511	1	511

PDB Hits     

FOYG_04169-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40549|MNT3_YEAST	1.62e-19	181	453	260	536	Alpha-1,3-mannosyltransferase MNT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT3 PE=1 SV=1
sp|Q59YS7|MNN14_CANAL	6.32e-15	116	455	234	578	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|P39106|MNN1_YEAST	2.78e-14	144	442	307	625	Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN1 PE=1 SV=1
sp|P53059|MNT2_YEAST	2.56e-12	140	443	158	462	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|Q59VL7|MNN15_CANAL	6.44e-10	58	442	182	577	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FOYG_04169-t42_1-p1.