CAZyme Information: FOYG_03937-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_03937-t42_1-p1
• CAZy Family: CBM63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		31715.96	10.1196

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717840.1:5066051-5067120(+)

Full Sequence      

MRLIKAFVAITAFLPRSFATRPTKSERFTSSTTGGKDGEVVRPRNNQELINYLKGNTARI
IYLERTFDFKGSEGNRLALSAFHQQEQLVNIKYDKAGLNSITVGSNKSIVGVGSKGVIKG
KGLRLANGVSNVIIQNIHITDLNPSLVWGGEAITLNGTDNIWIDHYTTTGVFCSSGPTIN
TILHVVNNYFRDIFDHAYEIDDKAQVLIEGNISRTSKIPLSPAGRVFGIPTSGSTGVCKA
ALGRACQLNAFRSSGDLPNDDSGFRGNFKGKSIAAITSAQNAKGVMTRDDFGIA

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	91	169	5.7e-36	0.4117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.33e-26	89	212	2	185	Amb_all domain.
226384	PelB	1.31e-15	18	167	37	162	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.74e-06	94	184	23	114	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI67702.1|PL1_4	3.45e-132	1	294	1	377
QKD46500.1|PL1_4	2.68e-124	1	294	1	377
QGI59750.1|PL1_4	8.79e-123	1	294	1	377
CCT63296.1|PL1_4	8.79e-123	1	294	1	377
QGI76951.1|PL1_4	8.79e-123	1	294	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.45e-57	25	275	7	340	Pectin Lyase B [Aspergillus niger]
1IDJ_A	4.91e-55	25	278	7	342	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.37e-54	25	278	7	342	Pectin Lyase A [Aspergillus niger]
1PCL_A	4.35e-07	32	167	18	150	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1VBL_A	8.73e-07	28	169	17	208	Structure of the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WV10|PELA_ASPFU	1.10e-61	1	278	1	363	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q5AQJ1|PELD_EMENI	1.59e-60	33	285	32	368	Probable pectin lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelD PE=3 SV=1
sp|Q5BA61|PELB_EMENI	4.69e-60	1	282	1	369	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q4WIS6|PELB_ASPFU	1.28e-59	25	278	25	361	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|B0XT36|PELA_ASPFC	1.28e-59	25	278	25	361	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.110073	0.889905	CS pos: 19-20. Pr: 0.8553

TMHMM  Annotations     

There is no transmembrane helices in FOYG_03937-t42_1-p1.