CAZyme Information: FOYG_03846-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_03846-t42_1-p1
• CAZy Family: CBM508
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		65991.92	5.8418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717840.1:4813942-4815830(+)

Full Sequence      

MAFVANGNEYDFIIVGGGTAGNTVAGRLAENPHVRILVIEAGIPNPHQIPEITTPSKAFN
LRGSKHDWAYKSTMIKRDDYERIEKPNTRGKVLGGSSCANYFTWIPGSKPTFDDWEAFGG
EDWNWEGCVEYLRKCATYHDEEGLYPSELGKIGTGGPIQIAHADLVPEMQPWRDALTEAW
VSKGEVLTENIYDGEMRGLTHCVDTIHGGQRQGSFLYLKNKPNVNILYGVQSKELIIDPH
TNTCLGVTVINPATKGELSVFASKEVILSQGVFETPKLLMLSGVGPAQELKKNDINVKLD
SPHVGQHLLDHPIVPFVLQVKDGFGLEDYILRDGAANSAAIAQYKRDKTGPVSSGLLELV
GFPRIDERLEQHQSYREAKAANGGLDPFGPKGQPHFELDFVGMFSTAFQWHYPVPEKGNY
MTVIVDLLRPLSEGQVTLNSNDPLVQPNINLNFFGNDLDILAMREGVRWTYDVLTTGKGF
KDIVLGEYPWRMPLESDEEMKRAVLDRSQTGFHPCGTARLSKNIQQGVVDSRLRVHGIKN
LRIADASVIPVIPDCRIQNSVYMIGEKGADMIKADHPEIFGQDAPTRINPFTSRL

Enzyme Prediction     

No EC number prediction in FOYG_03846-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	575	7.7e-148	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.82e-86	8	577	4	536	choline dehydrogenase; Validated
225186	BetA	1.25e-83	7	579	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.81e-43	430	567	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	7.04e-21	89	313	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.39e-18	8	565	54	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51991.1|AA3_2	0.0	1	595	1	595
CCT65282.1|AA3_2	0.0	1	595	1	594
QGI61436.1|AA3_2	0.0	1	580	1	580
QGI78622.1|AA3_2	0.0	1	580	1	580
QGI92334.1|AA3_2	0.0	1	580	1	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.82e-302	6	580	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	8.05e-302	6	580	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.30e-301	6	580	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	5.77e-73	9	575	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.13e-72	9	575	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	5.20e-61	9	572	40	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q8UH55|BETA_AGRFC	6.99e-59	9	577	2	530	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|A9AMZ9|BETA_BURM1	9.80e-59	9	577	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	6.98e-58	9	577	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	6.98e-58	9	577	5	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999571	0.000484

TMHMM  Annotations     

There is no transmembrane helices in FOYG_03846-t42_1-p1.