CAZyme Information: FOYG_03004-t42_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_03004-t42_3-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579		62901.52	5.1520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717840.1:2513297-2515135(-)

Full Sequence      

MSAMSFKAYSQTSSALYQLSGYSDAPKDWQPKETFEYDFLQIEPGDDAHAIETDVVIIGS
GCGGGVCAKNLAEAGHKVIVVDKAYHYPSTHLPMAQDAACAHLYDNAGFFMTEDSGCTVT
SGSAWGGGGTVNWSVCLKPQDFVREEWADEGLPFFTSAEFDECLDRVWEFQGAGTDQIRH
NHRNRVLLNGSSKLGWTARPAPVNTGGREHFCGQCHLGCGLAEKRGPAVSWLPDAAKAGA
QFMEGFQVDKILFDYDGQTAIGIEGEWVSRDSAGDMSDSNNRIKRRVIVRAKKVILAAGS
LWSPIVLKNSGITNPNVGANLHLHPCNFVTAVWKEETIPWEGGIITSYCPQFDNVDGSGY
GTKLETTCMVPFTILSQPSWTSGLDAKLHMTKLRHMNAWISLTRDRDAGSVFPDPTTGRP
RIDYTPSDFDRAHTIQGVEALAKICYVTGAVEIRPLLKGLEPFVRRGEASSEHSLDSKGS
VADPETTDPAFAAWLDRVREVGNKPPTAPWSSAHQMGTCRMSASSDEGVVDEKGRVWGTD
NLYVADGSVFPSASGVNPMITIMAIADWISRGVDADLRA

Enzyme Prediction     

No EC number prediction in FOYG_03004-t42_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	48	570	1.4e-50	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	3.07e-56	103	326	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	1.63e-42	46	575	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.41e-32	413	566	12	140	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	1.32e-07	514	572	473	533	choline dehydrogenase; Validated
274143	pyranose_ox	1.18e-05	508	566	477	535	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.48e-190	1	577	169	734
USW51778.1|AA3_1|AA8|CBM1	3.36e-14	54	573	270	798
ADT70776.1|AA3_1|AA8|1.1.99.18	5.48e-14	54	570	245	777
AUS45831.1|AA3_1|AA8|CBM1	9.00e-13	54	573	253	785
AGE97206.1|AA3_1|AA8	1.05e-11	45	567	226	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI4_A	2.00e-08	51	573	6	542	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	2.34e-08	51	573	228	764	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	2.12e-07	51	567	228	757	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
1CF3_A	1.27e-06	47	576	14	578	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
1NAA_A	2.13e-06	54	567	4	528	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	5.82e-88	49	578	235	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9LW56|FAO3_ARATH	2.55e-80	47	573	227	736	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.02e-79	51	573	235	740	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	3.84e-78	43	578	228	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	2.73e-71	46	573	217	718	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FOYG_03004-t42_3-p1.