CAZyme Information: FOYG_02447-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_02447-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		49308.53	6.1305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717840.1:878301-879808(+)

Full Sequence      

MGNGHSISIRDCLDAWAKPFNLEFPVIPAAVVRPQNVIEVSETVKCAKQSGLKVQAKSGG
HSYGNYGLGGDHGAVSIDLVNLKDFEMDNETWYASFGAGTNLGELDKNLHTFGRRAIAHG
TCPSVGTGGHLTVGGLGPISRMWGGALDHVVEMEVVTADGTIYLASQNRTPDLFWAMRGA
GASFGIVTRFVVKTRPEPGNIVQYSYSLTLNSQTETADLYKEWQALVGDPTMDRRFASLF
VVQPLGALITGTFFGSEAEYQASGIPARLPGASKGAVWLTNWMGHLLHEAEAAGCTLASI
PTAFYSKSLSLNEQDLLNDTAITNLFQYLEDSRSKSTPFTIIFNTEGGAMMDTPVNATAY
PHRDSVIMYQSYGIGVGKVSAATRKLLDGIHERIQRSAPGARSTYAGYVDAWLDRKAAQE
LYWADNLQRLQEIKKRWDPDQVFRNPQSVEPAD

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	19	449	8.2e-76	0.9868995633187773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.27e-28	28	162	1	135	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	6.76e-26	24	452	28	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.70e-12	404	450	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	2.31e-09	17	189	54	233	cytokinin dehydrogenase
273751	FAD_lactone_ox	4.95e-08	16	226	7	203	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK90596.1|AA7	2.48e-231	1	453	1	445
UNI23960.1|AA7	6.79e-197	1	453	1	473
QUC19098.1|AA7	1.39e-171	1	452	1	471
CCA70426.1|AA7	1.04e-139	18	452	83	518
QRD00400.1|AA7	7.51e-136	18	452	36	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	6.61e-67	17	453	50	496	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6Y0R_AAA	2.12e-61	20	451	53	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	5.29e-61	18	452	27	472	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	8.04e-59	20	451	35	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6YJO_A	5.16e-58	18	452	59	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	2.38e-87	19	451	36	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	3.40e-66	17	453	50	496	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|E9F5F1|SUBF_METRA	5.82e-61	19	452	54	492	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|I1S2K2|CHITO_GIBZE	1.09e-60	20	451	53	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	4.47e-60	18	452	49	494	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_02447-t42_1-p1.