CAZyme Information: FOYG_02189-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_02189-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	JH717840.1|CGC5	98580.60	6.0255

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717840.1:205415-208009(-)

Full Sequence      

MFRQIHLEKGWKFKQASSRNDGTASSFLPVAQFPTVAHIDLLHHELIPDPYIDINELKCL
WVNDADWTYRTEEISPVDLKQSEKAELVFEGLDTVVDVYLNDSHILFSNNMHKSHRVDVT
DMLRGREKPSVLELRFKAAPAYGRSERERIGYKTTKVGRGVNFGGSERLFVRKAQYHWGW
DWGPAINTCGPWKPIYLEVYESRVCDLRVTQDVAPDLSSVDIKVEAHLEGHNSINEVQVQ
LLDVETGTIVVDDKASKSTKGALSFTIKLNKPKLWYPFLYGEQNLYLLQVSIPNHTVSRK
LGIRRLRLLQHPLKDQPGTSFIFEVNNIRLFSGGSCWIPADFMLPRVSKETYEKWITVAK
AGNQSMIRVWGGGIVESDDFYDICDREGIMVWQDFLYACGNYPGSPDFVANVKIEAEQQV
QRVGHHPSLVLWCGNNEDYMCADGDRCWEVDYSDTTGPWDKTTFPAREIYERTLPSVIKT
SGTDVPYWISSPYGGSFSNDTTVGDTHCWDVWHGKLSPYQDYKVYTSRFISEFGFESAPS
LQTLHRAITSPKERHGQSRTFDVHDKGPGHQRRYPMYMGENYRFRMNPLRDFVYCTQFLQ
AEAMAYAYNCWRREFRGPGEENCAGVLVWQLNDIWPGISWALVDVNMNPKPAYYITKRAL
GKMVVGMERVVTEKPPYITTGYLDKKHKVDIWAVNGHLHEIRVTLEVKAFDIQSGKSIGW
TRSDESKEYALKGNRSTELLAGLEIPNPDETVVVAYLRDISSGEQVARWVSWPEPLKYVH
MSSDLKVTTEIVDDGSAVIVRANAPVKGVVLSASGSDGKNLVFDNNFIDLVPDEEVRIGV
TGLMGDRIDVRFLYDWELEPGFEL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	743	5.3e-86	0.6928191489361702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.71e-72	4	677	12	647	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	1.25e-14	688	778	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	5.95e-10	203	304	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	9.82e-08	784	855	3	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
395262	Glyco_hydro_10	0.006	622	654	266	306	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50554.1|GH2	0.0	1	864	1	864
QGI79970.1|GH2	0.0	1	864	1	864
QGI62799.1|GH2	0.0	1	864	1	864
QGI93688.1|GH2	0.0	1	864	1	864
CCT66619.1|GH2	0.0	1	864	1	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	7.41e-127	5	668	27	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	2.35e-114	7	841	11	817	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.46e-114	7	841	13	819	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.52e-114	7	841	13	819	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	6.54e-114	7	841	11	817	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	1.11e-237	5	853	7	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	8.51e-196	2	854	4	840	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q2TXB7|MANBB_ASPOR	9.80e-195	2	854	4	841	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	5.49e-194	2	854	4	841	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	4.61e-189	2	854	4	840	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_02189-t42_1-p1.