CAZyme Information: FOYG_02110-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_02110-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	JH717839.1|CGC26	27687.02	9.9452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:5395242-5396134(-)

Full Sequence      

MKFALFALSTLTASLAAAYPITGNDVKCRSGPGTSYAVKKVLKKGTDVKITCQTEGTNIS
GNTIWDKISDGCYVSDYYVKTGSSGYIKPKCGGGCSAPSSNQATVDLIGEFEGFVPHIYK
DAAGYPTVGYGHLCSNSKCTDVKYAIPLSKANGKKLLADDMRKFEKCIAKMVSSKVTLNK
NQFGALVSWSFNLGCGAAEGSQLLKRLNKGEKPNTVISQELPKWVYAGGRKLPGLVRRRN
AEVALAKKATSEKALPVKC

Enzyme Prediction     

No EC number prediction in FOYG_02110-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	102	242	7.7e-42	0.9781021897810219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	5.31e-60	105	245	2	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	4.07e-37	101	245	3	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	4.63e-33	103	245	7	140	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	4.70e-31	92	245	2	146	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	1.75e-14	125	239	1	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50435.1|GH24	2.08e-189	1	259	1	259
AEO71812.1|GH24	2.38e-129	1	259	1	261
AEO62022.1|GH24	4.66e-121	1	259	1	266
CCT75183.1|GH24	1.16e-112	1	259	1	258
QGJ01409.1|GH24	1.16e-112	1	259	1	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	6.68e-19	105	245	57	192	Chain A, Lysozyme [Acinetobacter baumannii]
7M5I_A	1.17e-14	105	242	14	149	Chain A, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
2ANV_A	6.67e-09	119	245	23	143	Chain A, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	9.67e-09	101	245	7	145	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q37896|ENLYS_BPB03	1.16e-17	101	245	4	141	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|P11187|ENLYS_BPPH2	1.49e-17	101	250	4	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	2.85e-17	101	250	4	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|Q9T1T5|ENLYS_BPAPS	8.19e-12	107	249	10	146	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
sp|P78285|LYSD_ECOLI	4.12e-10	119	242	42	156	Lysozyme RrrD OS=Escherichia coli (strain K12) OX=83333 GN=rrrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999762	CS pos: 18-19. Pr: 0.9651

TMHMM  Annotations     

There is no transmembrane helices in FOYG_02110-t42_1-p1.